Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6781
Gene name
Locationscaffold_61:21858..23147
Strand-
Gene length (bp)1289
Transcript length (bp)1173
Coding sequence length (bp)1173
Protein length (aa) 391

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74411|MEU10_SCHPO Meiotic expression up-regulated protein 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu10 PE=3 SV=1 3 338 5.0E-39
sp|D4AZK9|ECM33_ARTBC Cell surface GPI-anchored protein ARB_01627 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01627 PE=1 SV=1 6 368 8.0E-34
sp|Q4WNS8|ECM33_ASPFU Protein ecm33 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ecm33 PE=1 SV=1 39 347 1.0E-25
sp|Q12355|PST1_YEAST Cell wall mannoprotein PST1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PST1 PE=1 SV=1 39 339 2.0E-25
sp|A6ZY20|PST1_YEAS7 Cell wall mannoprotein PST1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PST1 PE=3 SV=1 39 339 2.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74411|MEU10_SCHPO Meiotic expression up-regulated protein 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu10 PE=3 SV=1 3 338 5.0E-39
sp|D4AZK9|ECM33_ARTBC Cell surface GPI-anchored protein ARB_01627 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01627 PE=1 SV=1 6 368 8.0E-34
sp|Q4WNS8|ECM33_ASPFU Protein ecm33 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ecm33 PE=1 SV=1 39 347 1.0E-25
sp|Q12355|PST1_YEAST Cell wall mannoprotein PST1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PST1 PE=1 SV=1 39 339 2.0E-25
sp|A6ZY20|PST1_YEAS7 Cell wall mannoprotein PST1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PST1 PE=3 SV=1 39 339 2.0E-25
sp|Q5AGC4|ECM33_CANAL Cell surface GPI-anchored protein ECM33 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ECM331 PE=1 SV=1 6 342 1.0E-24
sp|P08459|SPS2_YEAST Sporulation-specific protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS2 PE=1 SV=2 39 375 7.0E-23
sp|B5VE42|ECM33_YEAS6 Cell wall protein ECM33 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=ECM33 PE=3 SV=2 36 337 1.0E-22
sp|P38248|ECM33_YEAST Cell wall protein ECM33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM33 PE=1 SV=3 36 337 4.0E-22
sp|C7GQJ1|ECM33_YEAS2 Cell wall protein ECM33 OS=Saccharomyces cerevisiae (strain JAY291) GN=ECM33 PE=3 SV=1 36 337 4.0E-22
sp|A6ZL22|ECM33_YEAS7 Cell wall protein ECM33 OS=Saccharomyces cerevisiae (strain YJM789) GN=ECM33 PE=3 SV=2 36 337 6.0E-22
sp|O13960|ECM33_SCHPO Cell wall protein ecm33 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ecm33 PE=1 SV=2 39 310 7.0E-21
sp|P25380|SPS22_YEAST Sporulation-specific protein 22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS22 PE=3 SV=1 24 346 2.0E-20
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 1632.76 493.28 2772.24
CcL In ants, during behavior modification 1941.00 349.30 3532.69
CcD In ants, recently dead 2176.13 579.80 3772.46

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.671156 no
SC16a CcD 0.435815 no
CcL CcD 0.796803 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6781
MRSVTILSALVAVGSRAVSGATTCSEEIRITEPTPIINCDVIDANVVVDENVAGSLSIEGPKQLKKDLIVSNATK
LISISSTSINAVGGTLRLESLQLLSSCNLQALTSVVDMMLLNLPQLNGLTLGTEGVTKARRISIADTFISDLTGL
NIANCETIDISNNPKLTTFDSPLVNVTKSLKLTNNGNNMQVNMSSLQNCGEIQFRQVKSFDAPVLSRAESIKFND
SPELLSVSCSNLTEIAASLTLINNKKLNRLSFPLLKTIKGDMTIQNNTALQQVDGFPKVESVGNILLRGNFRNVT
LDQLRDVKGSAIATSTTDISAFCDFFSDLKKKGNIRGKESCTSNNKNANEEGGTGGQTSTDKEKDAAGIVSVNSA
LLSMAVLATLAQMVL*
Coding >Ophio5|6781
ATGCGTTCCGTCACCATTCTGTCGGCCCTTGTCGCCGTCGGCTCCCGAGCCGTGTCTGGTGCCACGACATGCTCC
GAAGAGATCCGAATCACCGAACCCACTCCCATCATCAACTGCGATGTCATCGACGCCAACGTCGTCGTCGACGAA
AACGTTGCCGGCAGCCTGAGCATCGAGGGGCCCAAGCAGCTCAAGAAGGACCTCATCGTTAGCAATGCCACCAAG
CTCATCTCCATATCCAGCACCTCCATCAACGCCGTCGGGGGCACGCTGCGACTCGAGAGCCTCCAGCTCCTCAGC
TCGTGCAACCTGCAGGCTCTGACGTCCGTCGTCGACATGATGCTGCTCAACCTGCCTCAGCTTAATGGACTGACG
TTGGGTACCGAGGGCGTCACTAAGGCGAGGCGCATCTCTATTGCCGACACGTTCATCAGCGACTTGACGGGCCTC
AACATTGCCAACTGCGAGACCATCGACATCTCCAACAACCCCAAGCTGACCACCTTCGACTCTCCCCTCGTCAAC
GTTACCAAGTCCCTCAAGCTCACCAACAACGGCAACAACATGCAGGTCAACATGTCGTCACTCCAGAACTGCGGT
GAGATTCAGTTCCGCCAGGTCAAGAGCTTCGACGCCCCCGTCCTGTCCAGGGCCGAGTCCATCAAGTTCAACGAC
AGCCCCGAGCTGCTGTCCGTCTCTTGCAGCAACCTAACCGAGATCGCGGCCAGCCTGACCCTCATCAACAACAAG
AAGCTCAACAGGCTTTCCTTCCCGCTTCTCAAGACCATCAAGGGAGACATGACGATTCAGAACAATACGGCACTT
CAACAGGTCGATGGCTTCCCTAAGGTGGAATCTGTCGGAAATATTTTGCTCCGTGGTAACTTCCGAAACGTCACC
CTCGATCAGCTCAGAGACGTCAAGGGCAGCGCCATTGCCACGTCGACGACGGATATCTCCGCCTTCTGCGACTTC
TTCTCCGATCTCAAAAAGAAGGGTAACATCCGCGGAAAGGAGTCGTGCACGAGCAACAACAAGAACGCCAACGAG
GAGGGCGGCACCGGCGGCCAAACCAGCACCGACAAGGAGAAGGACGCCGCCGGCATCGTCAGCGTCAATTCGGCT
CTGCTCAGTATGGCCGTCTTGGCGACGCTTGCGCAGATGGTGTTGTGA
Transcript >Ophio5|6781
ATGCGTTCCGTCACCATTCTGTCGGCCCTTGTCGCCGTCGGCTCCCGAGCCGTGTCTGGTGCCACGACATGCTCC
GAAGAGATCCGAATCACCGAACCCACTCCCATCATCAACTGCGATGTCATCGACGCCAACGTCGTCGTCGACGAA
AACGTTGCCGGCAGCCTGAGCATCGAGGGGCCCAAGCAGCTCAAGAAGGACCTCATCGTTAGCAATGCCACCAAG
CTCATCTCCATATCCAGCACCTCCATCAACGCCGTCGGGGGCACGCTGCGACTCGAGAGCCTCCAGCTCCTCAGC
TCGTGCAACCTGCAGGCTCTGACGTCCGTCGTCGACATGATGCTGCTCAACCTGCCTCAGCTTAATGGACTGACG
TTGGGTACCGAGGGCGTCACTAAGGCGAGGCGCATCTCTATTGCCGACACGTTCATCAGCGACTTGACGGGCCTC
AACATTGCCAACTGCGAGACCATCGACATCTCCAACAACCCCAAGCTGACCACCTTCGACTCTCCCCTCGTCAAC
GTTACCAAGTCCCTCAAGCTCACCAACAACGGCAACAACATGCAGGTCAACATGTCGTCACTCCAGAACTGCGGT
GAGATTCAGTTCCGCCAGGTCAAGAGCTTCGACGCCCCCGTCCTGTCCAGGGCCGAGTCCATCAAGTTCAACGAC
AGCCCCGAGCTGCTGTCCGTCTCTTGCAGCAACCTAACCGAGATCGCGGCCAGCCTGACCCTCATCAACAACAAG
AAGCTCAACAGGCTTTCCTTCCCGCTTCTCAAGACCATCAAGGGAGACATGACGATTCAGAACAATACGGCACTT
CAACAGGTCGATGGCTTCCCTAAGGTGGAATCTGTCGGAAATATTTTGCTCCGTGGTAACTTCCGAAACGTCACC
CTCGATCAGCTCAGAGACGTCAAGGGCAGCGCCATTGCCACGTCGACGACGGATATCTCCGCCTTCTGCGACTTC
TTCTCCGATCTCAAAAAGAAGGGTAACATCCGCGGAAAGGAGTCGTGCACGAGCAACAACAAGAACGCCAACGAG
GAGGGCGGCACCGGCGGCCAAACCAGCACCGACAAGGAGAAGGACGCCGCCGGCATCGTCAGCGTCAATTCGGCT
CTGCTCAGTATGGCCGTCTTGGCGACGCTTGCGCAGATGGTGTTGTGA
Gene >Ophio5|6781
ATGCGTTCCGTCACCATTCTGTCGGCCCTTGTCGCCGTCGGCTCCCGAGCCGTGTCTGGTGAGTCCCTCCCTGTC
TGCTGTGTGGCCGCATCTGACCAGTCCTTTTTTCGCCACAGGTGCCACGACATGCTCCGAAGAGATCCGAATCAC
CGAACCCACTCCCATCATCAACTGCGATGTCATCGACGCCAACGTCGTCGTCGACGAAAACGTTGCCGGCAGCCT
GAGCATCGAGGGGCCCAAGCAGCTCAAGAAGGACCTCATCGTTAGCAATGCCACCAAGCTCATCTCCATATCCAG
CACCTCCATCAACGCCGTCGGGGGCACGCTGCGACTCGAGAGCCTCCAGCTCCTCAGCTCGTGCAACCTGCAGGC
TCTGACGTCCGTCGTCGACATGATGCTGCTCAACCTGCCTCAGCTTAATGGACTGACGTTGGGTACCGAGGGCGT
CACTAAGGCGAGGCGCATCTCTATTGCCGACACGTTCATCAGCGACTTGACGGGCCTCAACATTGCCAACTGCGA
GACCATCGACATCTCCAACAACCCCAAGCTGACCACCTTCGACTCTCCCCTCGTCAACGTTACCAAGTCCCTCAA
GCTCACCAACAACGGCAACAACATGCAGGTCAACATGTCGTCACTCCAGAACTGCGGTGAGATTCAGTTCCGCCA
GGTCAAGAGCTTCGACGCCCCCGTCCTGTCCAGGGCCGAGTCCATCAAGTTCAACGACAGCCCCGAGCTGCTGTC
CGTCTCTTGCAGCAACCTAACCGAGATCGCGGCCAGCCTGACCCTCATCAACAACAAGAAGCTCAACAGGCTTTC
CTTCCCGCTTCTCAAGACCATCAAGGGAGACATGACGATTCAGAACAATACGGCACTTCAACAGGTCGATGGCTT
CCCTAAGGTGGAATCTGTCGGAAATATTTTGCTCCGTGGTAACTTCCGAAAGTACGTTGTGCCTCCCCTTCCCCC
CACGTCATGCTGCGGCCTGCTAACCGACGGGCAGCGTCACCCTCGATCAGCTCAGAGACGTCAAGGGCAGCGCCA
TTGCCACGTCGACGACGGATATCTCCGCCTTCTGCGACTTCTTCTCCGATCTCAAAAAGAAGGGTAACATCCGCG
GAAAGGAGTCGTGCACGAGCAACAACAAGAACGCCAACGAGGAGGGCGGCACCGGCGGCCAAACCAGCACCGACA
AGGAGAAGGACGCCGCCGGCATCGTCAGCGTCAATTCGGCTCTGCTCAGTATGGCCGTCTTGGCGACGCTTGCGC
AGATGGTGTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail