Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|678
Gene name
Locationscaffold_1183:993..2946
Strand+
Gene length (bp)1953
Transcript length (bp)1866
Coding sequence length (bp)1863
Protein length (aa) 621

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6952 0.306 0.0797 0.3117 0.236 0.0293 0.2113 0.2533 0.1779 0.1179

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2002
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5331
Ophiocordyceps australis map64 (Brazil) OphauB2|7634
Ophiocordyceps camponoti-floridani Ophcf2|00434
Ophiocordyceps camponoti-rufipedis Ophun1|7037
Ophiocordyceps kimflemingae Ophio5|678 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2242

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|678
MTPWNGAGHRVRPRSENKSIRGNISGPIPIPIPFTGPADDMAEAAAVSSAWHSSSSRQQQEMDVPTEVPPRSSRP
EQARSGSRHQQQQQQQQQQQQPARLAETTAGRGRSTIIKSALSRLLGRKKKTGLSSQLADRSTPAETSVQHHLSD
PMGETRPPKTLESKRSASLPVTEYDRALRSHSISPQDVLAIRSAGSSLNAESRTASNRAEASSATLAHLADPPHH
GWTEAAYKSPTALAPRPASSHGRHARPVDWSEDPDDIGRAVTSDASAWRRRSQSLSAVPHAHRALLRPTRRRSDD
VFSWREGYRYHDALVVTPPPSTPLTVDERGEAVGGDQHPFPSRLQSATAGRNVVTSAAGFDLRITDLEARMARLE
HVVAELTDSLARLAPWSAAQDGKMLFAHRPHDPSKMAVCPDMVPPRATTTTLGTSSDGSRPLSLATVRDNTSHQE
MMTTDHYLTLVGLLETERSAREMLEVQVRSLGHQMYMAFKATTTSPPSAGDSSAFDLDEDEDGNEDGVKAVMKGL
PAPPSSLSSTTTSSSSHARGWDEYDEYDDDVDRKTFSNSLAARSQDGPPSTKADDQTADETVSTASARAMSLSRL
TLGIPPSPPPQQLPPPPRAVA
Coding >Ophio5|678
ATGACGCCGTGGAACGGTGCCGGTCACCGTGTCAGGCCCCGCTCCGAGAACAAGTCCATCCGGGGCAACATCTCG
GGCCCGATCCCGATCCCGATCCCATTTACCGGCCCCGCCGACGACATGGCGGAAGCCGCCGCCGTGTCGTCTGCG
TGGCACAGCAGCAGCAGTCGTCAGCAGCAGGAGATGGACGTGCCGACTGAGGTGCCTCCCCGTTCGTCCCGTCCG
GAGCAGGCCCGCTCCGGTAGCCGTCACCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCCGGCAAGGCTC
GCGGAGACGACGGCCGGCCGTGGCAGGTCGACCATCATCAAGTCGGCTTTGAGCAGGCTGCTGGGCCGTAAGAAG
AAGACGGGCTTGTCGAGTCAGTTGGCGGACAGGTCTACCCCGGCCGAGACGTCGGTCCAGCACCATCTCAGTGAC
CCGATGGGTGAGACCAGACCCCCCAAGACTCTCGAGTCGAAACGATCAGCCTCCCTGCCCGTGACGGAATATGAC
CGGGCCTTGCGATCCCATTCCATCAGTCCCCAAGACGTCCTGGCCATCCGGAGCGCCGGCAGCTCGCTCAACGCC
GAGTCCCGGACGGCCAGCAACAGGGCCGAAGCCTCGTCCGCCACGCTCGCCCACCTCGCTGACCCTCCTCACCAT
GGCTGGACCGAGGCTGCCTACAAGTCGCCGACGGCTCTGGCCCCGCGACCTGCGAGCTCGCACGGCCGTCATGCT
AGGCCGGTCGACTGGAGCGAGGATCCGGATGATATTGGCCGTGCCGTCACGAGCGATGCTTCCGCTTGGAGGAGG
AGGTCCCAGAGTCTCTCGGCCGTTCCCCACGCCCATCGTGCTCTTCTCCGCCCGACGAGGAGACGGAGCGACGAC
GTCTTTTCCTGGAGAGAGGGATACCGATACCATGATGCCCTTGTCGTCACCCCGCCTCCCTCGACCCCTCTCACC
GTCGACGAGCGGGGGGAGGCGGTCGGTGGCGACCAGCATCCGTTCCCGTCTCGCCTCCAGTCCGCCACCGCCGGC
CGTAACGTCGTCACCTCGGCTGCCGGCTTCGACTTGCGCATCACCGACCTCGAGGCTCGCATGGCCAGGCTGGAG
CACGTCGTCGCCGAGCTGACCGACTCGCTGGCGAGATTGGCCCCTTGGTCGGCGGCGCAGGACGGCAAGATGCTC
TTCGCCCACCGCCCGCATGATCCGTCCAAGATGGCCGTCTGTCCGGACATGGTACCACCTCGGGCGACGACGACG
ACACTTGGGACCAGTTCCGACGGCAGTCGACCTCTTTCTCTCGCCACCGTGCGCGACAACACCTCCCACCAAGAG
ATGATGACGACGGATCACTACCTCACCCTCGTCGGCCTCCTGGAGACGGAGCGCTCCGCTCGCGAGATGCTCGAG
GTTCAGGTCCGGAGCCTGGGCCACCAGATGTACATGGCCTTCAAGGCGACGACGACGAGCCCGCCGTCGGCAGGC
GACTCTTCCGCCTTTGACCTGGACGAGGACGAGGACGGGAACGAGGATGGCGTCAAGGCGGTGATGAAGGGGCTT
CCCGCCCCTCCTTCTTCCCTCTCTTCTACTACCACTTCTTCATCTTCTCACGCCCGAGGCTGGGACGAGTACGAC
GAGTACGACGACGACGTGGACCGCAAGACTTTTAGCAACTCCTTGGCCGCCCGGAGTCAAGATGGACCCCCGTCG
ACGAAGGCCGACGACCAGACTGCCGACGAGACCGTCTCCACGGCGTCGGCCAGAGCAATGTCCCTCTCGCGACTG
ACGCTGGGCATTCCGCCTTCTCCTCCCCCGCAGCAGCTGCCCCCTCCTCCTCGCGCCGTGGCC
Transcript >Ophio5|678
ATGACGCCGTGGAACGGTGCCGGTCACCGTGTCAGGCCCCGCTCCGAGAACAAGTCCATCCGGGGCAACATCTCG
GGCCCGATCCCGATCCCGATCCCATTTACCGGCCCCGCCGACGACATGGCGGAAGCCGCCGCCGTGTCGTCTGCG
TGGCACAGCAGCAGCAGTCGTCAGCAGCAGGAGATGGACGTGCCGACTGAGGTGCCTCCCCGTTCGTCCCGTCCG
GAGCAGGCCCGCTCCGGTAGCCGTCACCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCCGGCAAGGCTC
GCGGAGACGACGGCCGGCCGTGGCAGGTCGACCATCATCAAGTCGGCTTTGAGCAGGCTGCTGGGCCGTAAGAAG
AAGACGGGCTTGTCGAGTCAGTTGGCGGACAGGTCTACCCCGGCCGAGACGTCGGTCCAGCACCATCTCAGTGAC
CCGATGGGTGAGACCAGACCCCCCAAGACTCTCGAGTCGAAACGATCAGCCTCCCTGCCCGTGACGGAATATGAC
CGGGCCTTGCGATCCCATTCCATCAGTCCCCAAGACGTCCTGGCCATCCGGAGCGCCGGCAGCTCGCTCAACGCC
GAGTCCCGGACGGCCAGCAACAGGGCCGAAGCCTCGTCCGCCACGCTCGCCCACCTCGCTGACCCTCCTCACCAT
GGCTGGACCGAGGCTGCCTACAAGTCGCCGACGGCTCTGGCCCCGCGACCTGCGAGCTCGCACGGCCGTCATGCT
AGGCCGGTCGACTGGAGCGAGGATCCGGATGATATTGGCCGTGCCGTCACGAGCGATGCTTCCGCTTGGAGGAGG
AGGTCCCAGAGTCTCTCGGCCGTTCCCCACGCCCATCGTGCTCTTCTCCGCCCGACGAGGAGACGGAGCGACGAC
GTCTTTTCCTGGAGAGAGGGATACCGATACCATGATGCCCTTGTCGTCACCCCGCCTCCCTCGACCCCTCTCACC
GTCGACGAGCGGGGGGAGGCGGTCGGTGGCGACCAGCATCCGTTCCCGTCTCGCCTCCAGTCCGCCACCGCCGGC
CGTAACGTCGTCACCTCGGCTGCCGGCTTCGACTTGCGCATCACCGACCTCGAGGCTCGCATGGCCAGGCTGGAG
CACGTCGTCGCCGAGCTGACCGACTCGCTGGCGAGATTGGCCCCTTGGTCGGCGGCGCAGGACGGCAAGATGCTC
TTCGCCCACCGCCCGCATGATCCGTCCAAGATGGCCGTCTGTCCGGACATGGTACCACCTCGGGCGACGACGACG
ACACTTGGGACCAGTTCCGACGGCAGTCGACCTCTTTCTCTCGCCACCGTGCGCGACAACACCTCCCACCAAGAG
ATGATGACGACGGATCACTACCTCACCCTCGTCGGCCTCCTGGAGACGGAGCGCTCCGCTCGCGAGATGCTCGAG
GTTCAGGTCCGGAGCCTGGGCCACCAGATGTACATGGCCTTCAAGGCGACGACGACGAGCCCGCCGTCGGCAGGC
GACTCTTCCGCCTTTGACCTGGACGAGGACGAGGACGGGAACGAGGATGGCGTCAAGGCGGTGATGAAGGGGCTT
CCCGCCCCTCCTTCTTCCCTCTCTTCTACTACCACTTCTTCATCTTCTCACGCCCGAGGCTGGGACGAGTACGAC
GAGTACGACGACGACGTGGACCGCAAGACTTTTAGCAACTCCTTGGCCGCCCGGAGTCAAGATGGACCCCCGTCG
ACGAAGGCCGACGACCAGACTGCCGACGAGACCGTCTCCACGGCGTCGGCCAGAGCAATGTCCCTCTCGCGACTG
ACGCTGGGCATTCCGCCTTCTCCTCCCCCGCAGCAGCTGCCCCCTCCTCCTCGCGCCGTGGCCTGA
Gene >Ophio5|678
ATGACGCCGTGGAACGGTGCCGGTCACCGTGTCAGGCCCCGCTCCGAGAACAAGTCCATCCGGGGCAACATCTCG
GGCCCGATCCCGATCCCGATCCCATTTACCGGCCCCGCCGACGACATGGCGGAAGCCGCCGCCGTGTCGTCTGCG
TGGCACAGCAGCAGCAGTCGTCAGCAGCAGGAGATGGACGTGCCGACTGAGGTGCCTCCCCGTTCGTCCCGTCCG
GAGCAGGCCCGCTCCGGTAGCCGTCACCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCCGGCAAGGCTC
GCGGAGACGACGGCCGGCCGTGGCAGGTCGACCATCATCAAGTCGGCTTTGAGCAGGCTGCTGGGCCGTAAGAAG
AAGACGGGCTTGTCGAGTCAGTTGGCGGACAGGTCTACCCCGGCCGAGACGTCGGTCCAGCACCATCTCAGTGTA
AGTTGGGCGTCTTTTTTTAATTATTCTTCTTCTCCCTCTCTCTCTTTCTCTCCCATCTTCTCAAAAACCGTCTCC
GGACGGCAGGACCCGATGGGTGAGACCAGACCCCCCAAGACTCTCGAGTCGAAACGATCAGCCTCCCTGCCCGTG
ACGGAATATGACCGGGCCTTGCGATCCCATTCCATCAGTCCCCAAGACGTCCTGGCCATCCGGAGCGCCGGCAGC
TCGCTCAACGCCGAGTCCCGGACGGCCAGCAACAGGGCCGAAGCCTCGTCCGCCACGCTCGCCCACCTCGCTGAC
CCTCCTCACCATGGCTGGACCGAGGCTGCCTACAAGTCGCCGACGGCTCTGGCCCCGCGACCTGCGAGCTCGCAC
GGCCGTCATGCTAGGCCGGTCGACTGGAGCGAGGATCCGGATGATATTGGCCGTGCCGTCACGAGCGATGCTTCC
GCTTGGAGGAGGAGGTCCCAGAGTCTCTCGGCCGTTCCCCACGCCCATCGTGCTCTTCTCCGCCCGACGAGGAGA
CGGAGCGACGACGTCTTTTCCTGGAGAGAGGGATACCGATACCATGATGCCCTTGTCGTCACCCCGCCTCCCTCG
ACCCCTCTCACCGTCGACGAGCGGGGGGAGGCGGTCGGTGGCGACCAGCATCCGTTCCCGTCTCGCCTCCAGTCC
GCCACCGCCGGCCGTAACGTCGTCACCTCGGCTGCCGGCTTCGACTTGCGCATCACCGACCTCGAGGCTCGCATG
GCCAGGCTGGAGCACGTCGTCGCCGAGCTGACCGACTCGCTGGCGAGATTGGCCCCTTGGTCGGCGGCGCAGGAC
GGCAAGATGCTCTTCGCCCACCGCCCGCATGATCCGTCCAAGATGGCCGTCTGTCCGGACATGGTACCACCTCGG
GCGACGACGACGACACTTGGGACCAGTTCCGACGGCAGTCGACCTCTTTCTCTCGCCACCGTGCGCGACAACACC
TCCCACCAAGAGATGATGACGACGGATCACTACCTCACCCTCGTCGGCCTCCTGGAGACGGAGCGCTCCGCTCGC
GAGATGCTCGAGGTTCAGGTCCGGAGCCTGGGCCACCAGATGTACATGGCCTTCAAGGCGACGACGACGAGCCCG
CCGTCGGCAGGCGACTCTTCCGCCTTTGACCTGGACGAGGACGAGGACGGGAACGAGGATGGCGTCAAGGCGGTG
ATGAAGGGGCTTCCCGCCCCTCCTTCTTCCCTCTCTTCTACTACCACTTCTTCATCTTCTCACGCCCGAGGCTGG
GACGAGTACGACGAGTACGACGACGACGTGGACCGCAAGACTTTTAGCAACTCCTTGGCCGCCCGGAGTCAAGAT
GGACCCCCGTCGACGAAGGCCGACGACCAGACTGCCGACGAGACCGTCTCCACGGCGTCGGCCAGAGCAATGTCC
CTCTCGCGACTGACGCTGGGCATTCCGCCTTCTCCTCCCCCGCAGCAGCTGCCCCCTCCTCCTCGCGCCGTGGCC
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail