Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6778
Gene name
Locationscaffold_61:8098..15444
Strand-
Gene length (bp)7346
Transcript length (bp)7227
Coding sequence length (bp)7224
Protein length (aa) 2408

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.623 0.2965 0.1253 0.4928 0.1584 0.0362 0.1305 0.0718 0.1458 0.0302

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4984
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|02031
Ophiocordyceps camponoti-rufipedis Ophun1|5502
Ophiocordyceps kimflemingae Ophio5|6778 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2218
Ophiocordyceps subramaniannii Hirsu2|8292

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6778
MASGPGVQYCPYRTNLDLSNVQYADYSNVRYYQQAPDSDEEQVNDDNHDLNESAAGEPSHPSQPQSPVSVHSSNK
GQPKSAKDKRKERRKTKQKPSSPTAQDGRKQADEASEDESSPKIAKDKKHQQPSSPTAREAQKQPVEAGDEAKAV
NKKGKPQKKKRKQAKGQASATEQKTTTAASAHDGKEAKSPTTSDAAEPSSPETATASSEGKAGDHVDTVSPAEGG
QEAAAADKTEPADADKQDASAEASGEQAAASAEEPSAPTEEPTAPKVEPEPTEAADEPSVEEPAQPADCTPTEEP
VSISQVPEEPTADDDKNDAEGVKEDAPAEPSADPETKPGESPEPPVTTEDESKPKAEAASTAEATGEKQGETGDA
SADASEEPAATAAPSGDAAEDTATTEVEKEGSQEAPADNRAEAEAEAEAKTETHSESPQASEEPTTAQAKETATE
EAMTKESAAGGSKADDTEAEKTTAEGSKDENTAAEETKAEGSTAEDAKAEETDSKSETPIAEESKAGETKAMETQ
TAEGRAEETKAGEDPTEQPEAEVTTAAKAVAEETTPEETQAEKTQTEENTAAETKVGESPPEGKSEDTTAKDTKT
GQSVSEEKSEEITDKETKDKETTPEKSPAKETQTEETTEETKGSAENTQGHSETEDQKGIAGTAQRKETEAETDN
EKIEESTPDKSTSDETEKTTADQIDIKEPASSTELEAEQVDNQAATSVDGAQAEAAEKKGEETERSTDEQPKPPT
EQKSADETNGAVTQPDDVAKGAEKKADDGVAVSSNTGAPSITSPSKQVHFAEKDENIPLVTDAHSEDGEGPNAEE
TKPEDTSDHRMDAPTQAPDTKDTTEDTETASAQDVPVDEVETTGQGNADNAGEASAKADHDGESEEKRNDVSEPE
TTVASEAESEQLKSGESDGDKPAESSEDSKEDESATAQAGDGPAGEATEKGEGSDDKADEQATRDQDAISDAAGE
PESAPGPDAPASEAVKPEKNSAAEEEKSTPDSKEGAAPGVVTQEKEKGVDEVTETAPNDGPETEASVVLNTEPTG
ADAAAETNEDGHQSTEESPQSSEDTAAGAPDESKDEPASSKDTDTEAAADGEVDAASPKAGNEKEPSGETGTQAG
TEEPMVATDEPKEPSSTETDTVADVPKDAEKDDTAAAAEAEAAEVRKETEAPVEAVPSVTEASAEPETATEAEAS
KEAPAPETVQDSEGGQTTEKPDATEEAEAREEVDASQEAEAVKKEAFAEAEAPKEEASTETEAPKEPDAPLGVEA
STGEAPAEAKESEKEASAETVAESPKEPEAATEAKTEAPEEPDVSTEAEAETPKEPGAPTETEAEVPKESEASTK
VEAEAPKEPDAPADAEASKQPEAPTETEAVAPKEPEAPTEAQASKQPEASSKTEAVAPEEPEAPTKPVASTVTEV
AEEQQASKEEPSTEAEAPADAEVPKEAEAETSAVTETHKGAEAPRDSPGEAEAPKETETTGSPEATKETATAAEA
EAPAEIKAEEATKDAAAEMTTPAEAAAVSGEAEAPKEVKAEAQKEDATAETEAPTEDAPEAAAAASEEAKASEEA
EAEAPKDDAPAEAGDQLVEEAAPKAAAESAESAEPAEEKDAEPEAEPESEAKTEPAEEAPAPDADEVAAQVNGDD
GQAQDEAKLSTEEEGAPATEEAAAADAQIKEAAEDTEKAAPTEAETDGVSAAGAAAAVAGAGAAAAVAAAAAAAA
AKVHDAAEEGDAEPSTPPRHVAEEEEEEEEAGPPLPPRHDAAVEESGPRLPPRDSDAVVEEEESKDTVGPIPKAK
GEAMTRLKRGKEHSSFSDALFPLSEASSGSRLCQQGGDRASDFKEQESIVKAGNNDFVMQAPKPMEAKRIGKQVQ
PLQGGQISEKELLGWQTKEVIKGISEGSEQRAKSSTNAFLRPAPEGLPDESQSPAEDEDTLEQIGSDTATAGDAQ
DIAPGSSQELHYGQSLVMESIGAAAALGFALMALGGTSLEGQASEPSVEAGQALPLLATCEETSEAATPDIEIPD
TAMIQLDRNSRAGRKRGLALRDAEETVAAAVVIYAAAEALSRPSPVSDALEDRGIGDGSQQMDSDRDSKRETGHS
SADKDKEGHRKRLSHHSSRSGGDEAAKENRRRSSHNSHSSSRRPRQDSESSNQARAAGKRHDSGHSGESSGSSGR
RRRNADEQADHDREKAERRRAANEQAEQEKRRAERRRNADEQERRKSERRHKDKEATRGEQSNVVHKTREAERAK
EAEGQPERSQRSSRRHSHSSSQQPRPEGAPEKRFFDVRNSEGIVGRGPPTPPMTSESGQPSPTPHGPRRSSTSHS
KHSNGRQSSDQPRAKSTRSRESNGSDENGGPSRQPATEDGARQARRHKRNGMNEREERKRVREEEKKAGGIRGLM
KRLFTSSS
Coding >Ophio5|6778
ATGGCTTCCGGCCCGGGTGTCCAATACTGTCCGTATCGGACTAATCTTGACTTGTCCAACGTGCAATACGCCGAC
TATTCTAATGTTCGATACTACCAGCAGGCTCCTGATTCTGATGAGGAGCAGGTCAACGACGACAATCATGACTTG
AACGAATCCGCCGCTGGGGAGCCCAGTCACCCGAGTCAACCGCAATCACCCGTCAGTGTCCACTCCTCCAACAAA
GGGCAACCGAAGTCGGCGAAAGATAAGCGAAAGGAGAGAAGAAAGACCAAACAGAAGCCCTCATCACCCACTGCA
CAAGATGGCCGGAAGCAAGCGGATGAAGCGAGTGAGGACGAATCGAGTCCGAAGATTGCCAAGGACAAGAAGCAC
CAACAACCTTCATCACCAACTGCTCGAGAGGCTCAAAAGCAGCCTGTAGAAGCGGGCGACGAGGCGAAAGCCGTC
AACAAGAAGGGTAAACCCCAGAAGAAAAAGAGGAAGCAGGCCAAAGGCCAGGCTTCCGCAACTGAGCAAAAGACA
ACAACAGCCGCCTCCGCACATGATGGCAAAGAAGCGAAGAGTCCGACGACATCGGACGCCGCGGAACCCTCTAGC
CCTGAAACGGCCACTGCATCTTCTGAGGGAAAGGCTGGTGACCATGTCGACACCGTGTCCCCCGCTGAGGGTGGC
CAGGAAGCGGCTGCCGCAGATAAAACTGAGCCCGCCGATGCGGATAAACAGGATGCGAGTGCGGAGGCCTCGGGA
GAACAGGCCGCCGCTTCGGCTGAAGAGCCTTCAGCGCCGACCGAGGAGCCCACAGCGCCTAAAGTTGAGCCAGAG
CCAACTGAAGCTGCCGACGAGCCGTCAGTCGAAGAGCCCGCACAACCTGCAGACTGTACTCCTACCGAGGAGCCT
GTGTCAATATCCCAAGTGCCGGAAGAACCGACTGCTGATGACGACAAGAACGACGCCGAGGGGGTGAAAGAGGAC
GCACCCGCAGAGCCATCAGCTGATCCCGAAACCAAACCGGGAGAAAGCCCAGAGCCACCCGTCACCACCGAAGAC
GAGTCGAAGCCGAAAGCGGAAGCCGCCTCGACGGCAGAAGCGACCGGAGAAAAGCAAGGCGAGACGGGCGACGCA
TCTGCAGATGCATCCGAGGAGCCCGCTGCCACCGCGGCTCCTTCGGGCGATGCAGCCGAAGACACTGCTACTACC
GAGGTCGAGAAAGAAGGGAGTCAGGAGGCTCCAGCAGACAATCGGGCGGAAGCGGAAGCGGAAGCGGAAGCGAAG
ACGGAGACGCACTCGGAGTCCCCTCAGGCCAGCGAGGAGCCTACGACAGCTCAGGCTAAGGAGACTGCAACCGAG
GAGGCCATGACCAAGGAGTCTGCTGCCGGGGGAAGCAAAGCCGACGATACCGAAGCTGAAAAGACTACAGCTGAG
GGAAGCAAAGACGAGAACACCGCAGCCGAGGAGACCAAGGCCGAGGGAAGCACAGCTGAAGACGCCAAAGCCGAG
GAGACGGACAGCAAGTCTGAAACTCCTATAGCTGAAGAAAGCAAAGCCGGAGAGACCAAGGCTATGGAGACTCAA
ACAGCGGAGGGCAGGGCTGAGGAAACTAAAGCCGGCGAGGATCCTACCGAGCAGCCTGAGGCCGAAGTGACTACA
GCCGCGAAGGCCGTGGCGGAAGAGACGACGCCTGAGGAAACCCAGGCTGAAAAGACACAGACTGAAGAAAACACA
GCTGCTGAGACAAAGGTCGGAGAGTCTCCCCCGGAAGGAAAGTCTGAAGATACTACGGCTAAGGATACCAAGACT
GGACAGTCTGTGTCTGAGGAAAAGTCCGAAGAAATAACGGACAAGGAGACCAAGGATAAAGAGACTACGCCCGAG
AAAAGTCCAGCTAAAGAGACCCAGACTGAAGAGACAACTGAAGAGACAAAGGGTTCGGCCGAAAACACTCAAGGT
CACTCAGAGACCGAGGACCAAAAGGGAATTGCCGGCACAGCGCAGCGGAAAGAAACAGAAGCCGAAACGGATAAT
GAGAAGATTGAGGAATCAACGCCCGACAAATCGACATCAGACGAAACAGAAAAGACGACAGCAGACCAGATCGAC
ATAAAGGAGCCCGCTTCGTCCACAGAACTTGAAGCTGAGCAGGTTGACAATCAAGCTGCCACCTCAGTTGATGGG
GCGCAGGCCGAGGCCGCAGAGAAGAAAGGTGAAGAAACTGAGCGGTCGACCGACGAGCAACCAAAACCCCCTACG
GAACAAAAGTCAGCCGACGAGACCAACGGGGCTGTCACCCAACCAGACGACGTAGCGAAGGGCGCCGAGAAGAAA
GCCGACGACGGTGTTGCTGTGTCTTCCAATACAGGGGCCCCATCGATTACCTCTCCCTCCAAGCAGGTTCACTTT
GCCGAGAAAGATGAGAACATTCCTCTTGTAACCGATGCTCATTCGGAAGATGGTGAAGGCCCTAACGCGGAGGAA
ACTAAGCCCGAGGATACTTCAGACCATCGCATGGATGCTCCAACACAAGCACCAGATACGAAAGACACAACTGAA
GACACCGAAACCGCATCAGCCCAGGATGTCCCTGTAGATGAAGTCGAGACTACGGGGCAAGGGAACGCCGATAAC
GCAGGAGAAGCTTCTGCTAAGGCTGATCATGATGGAGAATCGGAAGAAAAGCGAAACGATGTGTCTGAACCCGAG
ACTACCGTTGCCTCGGAGGCAGAATCAGAGCAGCTGAAGTCTGGAGAGTCCGACGGCGATAAGCCAGCTGAGTCT
AGTGAGGATTCGAAAGAAGACGAGTCCGCTACCGCCCAAGCTGGAGATGGTCCCGCCGGGGAGGCCACCGAGAAA
GGCGAGGGTTCTGACGACAAAGCTGATGAACAAGCGACTCGGGATCAAGACGCCATTTCCGATGCAGCTGGGGAG
CCTGAGAGTGCGCCTGGGCCGGATGCTCCCGCTTCTGAGGCAGTAAAGCCAGAGAAGAACAGTGCTGCCGAGGAG
GAGAAATCCACCCCGGATTCGAAGGAAGGTGCAGCGCCCGGCGTAGTGACCCAGGAGAAAGAAAAGGGCGTCGAC
GAGGTGACGGAGACTGCTCCCAACGACGGCCCGGAAACAGAGGCAAGCGTTGTGTTGAATACCGAGCCTACCGGC
GCCGACGCTGCGGCCGAAACGAATGAAGATGGACACCAGTCTACCGAAGAGTCTCCTCAATCCTCTGAAGATACT
GCTGCAGGGGCGCCGGATGAATCCAAAGACGAGCCGGCATCCTCCAAAGACACTGACACGGAGGCGGCCGCAGAT
GGCGAAGTCGATGCTGCCTCCCCTAAGGCCGGCAATGAGAAGGAGCCCTCTGGTGAAACTGGAACCCAAGCAGGG
ACCGAAGAGCCGATGGTAGCAACCGATGAGCCAAAAGAACCGTCTTCGACGGAAACGGACACTGTCGCCGATGTG
CCAAAGGATGCCGAGAAAGACGACACGGCTGCTGCCGCTGAAGCCGAGGCAGCCGAGGTTAGAAAAGAGACTGAA
GCTCCAGTGGAAGCCGTGCCTTCGGTGACAGAGGCTTCTGCAGAGCCGGAGACTGCTACCGAGGCCGAGGCATCC
AAAGAGGCACCGGCGCCCGAGACTGTCCAGGACTCTGAGGGGGGGCAAACGACTGAAAAACCGGACGCCACTGAG
GAGGCTGAAGCCCGCGAGGAAGTGGATGCTTCTCAAGAGGCCGAAGCAGTCAAGAAAGAAGCTTTTGCTGAAGCC
GAGGCGCCCAAGGAAGAAGCCTCTACTGAGACAGAGGCTCCAAAAGAGCCAGATGCTCCTTTAGGGGTGGAGGCC
TCAACGGGTGAAGCGCCCGCTGAGGCCAAGGAATCCGAGAAAGAGGCTTCCGCAGAGACTGTGGCAGAATCGCCC
AAGGAGCCTGAAGCTGCTACGGAGGCGAAGACAGAAGCACCCGAGGAGCCTGACGTTTCTACGGAGGCGGAAGCG
GAGACGCCCAAGGAGCCTGGGGCACCTACGGAGACGGAGGCGGAAGTGCCTAAAGAGTCTGAGGCTTCCACGAAA
GTAGAAGCAGAAGCGCCTAAGGAGCCTGACGCACCTGCGGACGCTGAGGCATCCAAGCAACCCGAAGCTCCCACG
GAGACTGAAGCAGTGGCACCTAAGGAGCCTGAAGCACCTACGGAGGCTCAGGCATCCAAGCAACCCGAAGCTTCC
AGTAAGACGGAAGCAGTAGCGCCTGAGGAACCCGAAGCACCCACGAAGCCTGTAGCTTCCACCGTGACGGAAGTG
GCAGAGGAACAGCAGGCCTCAAAAGAAGAACCCTCTACTGAGGCCGAGGCTCCCGCTGACGCGGAGGTGCCAAAG
GAAGCCGAGGCGGAGACGTCTGCGGTGACGGAGACTCACAAGGGTGCCGAGGCGCCTAGAGACTCACCCGGAGAA
GCCGAGGCTCCAAAGGAAACAGAGACGACCGGTTCACCGGAGGCTACTAAGGAGACGGCTACGGCAGCAGAAGCC
GAAGCACCTGCGGAGATCAAGGCAGAGGAGGCTACCAAGGACGCTGCCGCAGAGATGACGACTCCCGCAGAGGCG
GCGGCGGTGTCTGGGGAAGCCGAAGCTCCTAAGGAGGTGAAGGCGGAAGCGCAAAAGGAAGATGCTACCGCGGAG
ACGGAGGCACCGACGGAAGACGCTCCCGAGGCGGCGGCGGCAGCGTCAGAGGAAGCGAAGGCTTCCGAGGAGGCG
GAAGCGGAGGCTCCCAAAGACGACGCTCCCGCGGAGGCTGGAGATCAACTTGTCGAGGAAGCGGCCCCCAAGGCA
GCGGCCGAGAGCGCAGAGTCCGCAGAGCCGGCCGAAGAGAAGGACGCAGAGCCGGAGGCTGAGCCGGAAAGCGAA
GCCAAGACGGAGCCAGCCGAGGAGGCGCCGGCGCCCGACGCTGACGAGGTCGCGGCGCAGGTGAATGGCGATGAC
GGACAAGCCCAGGACGAAGCCAAACTGTCGACCGAGGAAGAGGGGGCTCCAGCTACCGAGGAGGCAGCAGCAGCG
GATGCTCAGATCAAAGAGGCGGCCGAAGACACAGAAAAAGCAGCCCCCACTGAGGCCGAGACAGATGGAGTGTCC
GCCGCCGGAGCTGCTGCAGCGGTGGCAGGGGCGGGAGCAGCAGCGGCAGTAGCAGCAGCAGCAGCAGCAGCAGCA
GCCAAAGTGCACGATGCGGCAGAAGAGGGTGATGCTGAGCCTTCAACTCCACCACGGCATGTGGCGGAAGAAGAA
GAAGAAGAAGAAGAAGCCGGGCCTCCACTGCCCCCCCGCCATGATGCGGCGGTAGAAGAATCCGGGCCTCGGCTT
CCACCACGGGACAGCGATGCGGTGGTGGAGGAAGAAGAGAGCAAGGACACGGTTGGGCCCATTCCCAAGGCCAAG
GGCGAGGCTATGACAAGATTGAAAAGAGGTAAGGAACACAGTTCTTTCAGTGATGCTCTATTTCCTTTGTCGGAA
GCGTCTTCAGGGTCCAGGCTCTGTCAACAAGGTGGCGACAGAGCGTCGGACTTTAAGGAGCAAGAGTCGATTGTG
AAGGCTGGCAACAACGACTTTGTGATGCAGGCTCCGAAGCCGATGGAGGCCAAGCGCATTGGGAAGCAAGTTCAG
CCGCTCCAAGGGGGGCAAATATCGGAAAAGGAGTTGCTCGGATGGCAAACGAAAGAGGTTATCAAAGGCATATCA
GAGGGTTCGGAACAAAGAGCAAAATCTTCTACCAATGCCTTCTTGAGGCCAGCTCCGGAAGGGCTTCCTGATGAG
TCTCAGTCGCCGGCGGAAGATGAAGACACCTTGGAGCAGATCGGATCGGACACGGCCACTGCTGGCGACGCGCAA
GACATTGCACCTGGCTCATCTCAAGAGCTGCACTACGGACAAAGTCTGGTGATGGAGTCAATCGGGGCTGCTGCA
GCTTTGGGGTTCGCTCTCATGGCACTGGGAGGCACATCGCTGGAGGGACAAGCTTCCGAGCCCAGCGTCGAGGCC
GGCCAGGCACTTCCTCTACTGGCGACCTGCGAGGAGACCTCTGAAGCCGCAACACCTGATATCGAGATACCCGAC
ACGGCAATGATTCAGCTCGATCGGAACAGCAGAGCGGGGCGCAAAAGGGGTCTAGCTCTCCGTGATGCGGAAGAG
ACGGTGGCGGCAGCCGTCGTCATCTACGCAGCAGCAGAAGCACTGAGTCGTCCAAGCCCGGTCTCGGACGCGCTG
GAAGACAGAGGCATAGGCGATGGTTCCCAGCAGATGGATTCGGACCGGGACAGTAAGCGGGAGACGGGTCATTCG
AGCGCCGACAAAGACAAGGAAGGACATCGGAAACGGCTCTCACATCACTCGAGCCGAAGCGGCGGAGACGAGGCA
GCCAAGGAGAACCGACGACGTTCGTCGCACAACTCCCATTCGTCATCTCGGCGCCCTCGCCAAGACAGCGAGAGC
TCGAACCAGGCCAGGGCAGCCGGCAAGCGACACGACAGCGGGCACTCGGGAGAGAGCTCCGGAAGCTCGGGCAGG
AGACGGCGCAATGCAGATGAACAAGCGGATCACGACAGGGAGAAGGCCGAGCGACGGAGGGCCGCGAACGAGCAA
GCGGAGCAGGAGAAGCGAAGGGCCGAGCGACGGCGAAACGCGGACGAGCAGGAGAGGAGAAAGAGCGAGCGTCGA
CACAAGGACAAGGAGGCGACGCGGGGCGAGCAGTCGAACGTGGTGCACAAGACCAGGGAGGCAGAGAGGGCCAAA
GAGGCAGAGGGCCAGCCGGAGCGTAGCCAGCGATCATCGCGGCGACACAGCCACTCGAGCAGTCAGCAACCGCGA
CCGGAGGGGGCGCCAGAGAAGCGCTTCTTTGACGTGCGCAATTCCGAGGGCATCGTGGGACGGGGACCACCGACG
CCGCCCATGACGAGCGAATCGGGCCAGCCGTCTCCGACTCCGCATGGGCCTCGGCGATCGAGCACATCGCACTCC
AAGCACAGCAACGGGCGGCAGTCGAGCGACCAGCCGCGCGCCAAGTCGACCAGGTCGCGGGAGAGCAACGGCTCC
GACGAGAACGGCGGGCCGAGCCGACAGCCGGCGACGGAGGACGGGGCGCGACAGGCGCGACGACACAAGCGCAAT
GGCATGAATGAGCGGGAGGAGCGGAAAAGGGTCAGAGAGGAAGAGAAGAAGGCGGGGGGGATTCGTGGGCTGATG
AAGAGATTGTTTACTTCGTCGTCG
Transcript >Ophio5|6778
ATGGCTTCCGGCCCGGGTGTCCAATACTGTCCGTATCGGACTAATCTTGACTTGTCCAACGTGCAATACGCCGAC
TATTCTAATGTTCGATACTACCAGCAGGCTCCTGATTCTGATGAGGAGCAGGTCAACGACGACAATCATGACTTG
AACGAATCCGCCGCTGGGGAGCCCAGTCACCCGAGTCAACCGCAATCACCCGTCAGTGTCCACTCCTCCAACAAA
GGGCAACCGAAGTCGGCGAAAGATAAGCGAAAGGAGAGAAGAAAGACCAAACAGAAGCCCTCATCACCCACTGCA
CAAGATGGCCGGAAGCAAGCGGATGAAGCGAGTGAGGACGAATCGAGTCCGAAGATTGCCAAGGACAAGAAGCAC
CAACAACCTTCATCACCAACTGCTCGAGAGGCTCAAAAGCAGCCTGTAGAAGCGGGCGACGAGGCGAAAGCCGTC
AACAAGAAGGGTAAACCCCAGAAGAAAAAGAGGAAGCAGGCCAAAGGCCAGGCTTCCGCAACTGAGCAAAAGACA
ACAACAGCCGCCTCCGCACATGATGGCAAAGAAGCGAAGAGTCCGACGACATCGGACGCCGCGGAACCCTCTAGC
CCTGAAACGGCCACTGCATCTTCTGAGGGAAAGGCTGGTGACCATGTCGACACCGTGTCCCCCGCTGAGGGTGGC
CAGGAAGCGGCTGCCGCAGATAAAACTGAGCCCGCCGATGCGGATAAACAGGATGCGAGTGCGGAGGCCTCGGGA
GAACAGGCCGCCGCTTCGGCTGAAGAGCCTTCAGCGCCGACCGAGGAGCCCACAGCGCCTAAAGTTGAGCCAGAG
CCAACTGAAGCTGCCGACGAGCCGTCAGTCGAAGAGCCCGCACAACCTGCAGACTGTACTCCTACCGAGGAGCCT
GTGTCAATATCCCAAGTGCCGGAAGAACCGACTGCTGATGACGACAAGAACGACGCCGAGGGGGTGAAAGAGGAC
GCACCCGCAGAGCCATCAGCTGATCCCGAAACCAAACCGGGAGAAAGCCCAGAGCCACCCGTCACCACCGAAGAC
GAGTCGAAGCCGAAAGCGGAAGCCGCCTCGACGGCAGAAGCGACCGGAGAAAAGCAAGGCGAGACGGGCGACGCA
TCTGCAGATGCATCCGAGGAGCCCGCTGCCACCGCGGCTCCTTCGGGCGATGCAGCCGAAGACACTGCTACTACC
GAGGTCGAGAAAGAAGGGAGTCAGGAGGCTCCAGCAGACAATCGGGCGGAAGCGGAAGCGGAAGCGGAAGCGAAG
ACGGAGACGCACTCGGAGTCCCCTCAGGCCAGCGAGGAGCCTACGACAGCTCAGGCTAAGGAGACTGCAACCGAG
GAGGCCATGACCAAGGAGTCTGCTGCCGGGGGAAGCAAAGCCGACGATACCGAAGCTGAAAAGACTACAGCTGAG
GGAAGCAAAGACGAGAACACCGCAGCCGAGGAGACCAAGGCCGAGGGAAGCACAGCTGAAGACGCCAAAGCCGAG
GAGACGGACAGCAAGTCTGAAACTCCTATAGCTGAAGAAAGCAAAGCCGGAGAGACCAAGGCTATGGAGACTCAA
ACAGCGGAGGGCAGGGCTGAGGAAACTAAAGCCGGCGAGGATCCTACCGAGCAGCCTGAGGCCGAAGTGACTACA
GCCGCGAAGGCCGTGGCGGAAGAGACGACGCCTGAGGAAACCCAGGCTGAAAAGACACAGACTGAAGAAAACACA
GCTGCTGAGACAAAGGTCGGAGAGTCTCCCCCGGAAGGAAAGTCTGAAGATACTACGGCTAAGGATACCAAGACT
GGACAGTCTGTGTCTGAGGAAAAGTCCGAAGAAATAACGGACAAGGAGACCAAGGATAAAGAGACTACGCCCGAG
AAAAGTCCAGCTAAAGAGACCCAGACTGAAGAGACAACTGAAGAGACAAAGGGTTCGGCCGAAAACACTCAAGGT
CACTCAGAGACCGAGGACCAAAAGGGAATTGCCGGCACAGCGCAGCGGAAAGAAACAGAAGCCGAAACGGATAAT
GAGAAGATTGAGGAATCAACGCCCGACAAATCGACATCAGACGAAACAGAAAAGACGACAGCAGACCAGATCGAC
ATAAAGGAGCCCGCTTCGTCCACAGAACTTGAAGCTGAGCAGGTTGACAATCAAGCTGCCACCTCAGTTGATGGG
GCGCAGGCCGAGGCCGCAGAGAAGAAAGGTGAAGAAACTGAGCGGTCGACCGACGAGCAACCAAAACCCCCTACG
GAACAAAAGTCAGCCGACGAGACCAACGGGGCTGTCACCCAACCAGACGACGTAGCGAAGGGCGCCGAGAAGAAA
GCCGACGACGGTGTTGCTGTGTCTTCCAATACAGGGGCCCCATCGATTACCTCTCCCTCCAAGCAGGTTCACTTT
GCCGAGAAAGATGAGAACATTCCTCTTGTAACCGATGCTCATTCGGAAGATGGTGAAGGCCCTAACGCGGAGGAA
ACTAAGCCCGAGGATACTTCAGACCATCGCATGGATGCTCCAACACAAGCACCAGATACGAAAGACACAACTGAA
GACACCGAAACCGCATCAGCCCAGGATGTCCCTGTAGATGAAGTCGAGACTACGGGGCAAGGGAACGCCGATAAC
GCAGGAGAAGCTTCTGCTAAGGCTGATCATGATGGAGAATCGGAAGAAAAGCGAAACGATGTGTCTGAACCCGAG
ACTACCGTTGCCTCGGAGGCAGAATCAGAGCAGCTGAAGTCTGGAGAGTCCGACGGCGATAAGCCAGCTGAGTCT
AGTGAGGATTCGAAAGAAGACGAGTCCGCTACCGCCCAAGCTGGAGATGGTCCCGCCGGGGAGGCCACCGAGAAA
GGCGAGGGTTCTGACGACAAAGCTGATGAACAAGCGACTCGGGATCAAGACGCCATTTCCGATGCAGCTGGGGAG
CCTGAGAGTGCGCCTGGGCCGGATGCTCCCGCTTCTGAGGCAGTAAAGCCAGAGAAGAACAGTGCTGCCGAGGAG
GAGAAATCCACCCCGGATTCGAAGGAAGGTGCAGCGCCCGGCGTAGTGACCCAGGAGAAAGAAAAGGGCGTCGAC
GAGGTGACGGAGACTGCTCCCAACGACGGCCCGGAAACAGAGGCAAGCGTTGTGTTGAATACCGAGCCTACCGGC
GCCGACGCTGCGGCCGAAACGAATGAAGATGGACACCAGTCTACCGAAGAGTCTCCTCAATCCTCTGAAGATACT
GCTGCAGGGGCGCCGGATGAATCCAAAGACGAGCCGGCATCCTCCAAAGACACTGACACGGAGGCGGCCGCAGAT
GGCGAAGTCGATGCTGCCTCCCCTAAGGCCGGCAATGAGAAGGAGCCCTCTGGTGAAACTGGAACCCAAGCAGGG
ACCGAAGAGCCGATGGTAGCAACCGATGAGCCAAAAGAACCGTCTTCGACGGAAACGGACACTGTCGCCGATGTG
CCAAAGGATGCCGAGAAAGACGACACGGCTGCTGCCGCTGAAGCCGAGGCAGCCGAGGTTAGAAAAGAGACTGAA
GCTCCAGTGGAAGCCGTGCCTTCGGTGACAGAGGCTTCTGCAGAGCCGGAGACTGCTACCGAGGCCGAGGCATCC
AAAGAGGCACCGGCGCCCGAGACTGTCCAGGACTCTGAGGGGGGGCAAACGACTGAAAAACCGGACGCCACTGAG
GAGGCTGAAGCCCGCGAGGAAGTGGATGCTTCTCAAGAGGCCGAAGCAGTCAAGAAAGAAGCTTTTGCTGAAGCC
GAGGCGCCCAAGGAAGAAGCCTCTACTGAGACAGAGGCTCCAAAAGAGCCAGATGCTCCTTTAGGGGTGGAGGCC
TCAACGGGTGAAGCGCCCGCTGAGGCCAAGGAATCCGAGAAAGAGGCTTCCGCAGAGACTGTGGCAGAATCGCCC
AAGGAGCCTGAAGCTGCTACGGAGGCGAAGACAGAAGCACCCGAGGAGCCTGACGTTTCTACGGAGGCGGAAGCG
GAGACGCCCAAGGAGCCTGGGGCACCTACGGAGACGGAGGCGGAAGTGCCTAAAGAGTCTGAGGCTTCCACGAAA
GTAGAAGCAGAAGCGCCTAAGGAGCCTGACGCACCTGCGGACGCTGAGGCATCCAAGCAACCCGAAGCTCCCACG
GAGACTGAAGCAGTGGCACCTAAGGAGCCTGAAGCACCTACGGAGGCTCAGGCATCCAAGCAACCCGAAGCTTCC
AGTAAGACGGAAGCAGTAGCGCCTGAGGAACCCGAAGCACCCACGAAGCCTGTAGCTTCCACCGTGACGGAAGTG
GCAGAGGAACAGCAGGCCTCAAAAGAAGAACCCTCTACTGAGGCCGAGGCTCCCGCTGACGCGGAGGTGCCAAAG
GAAGCCGAGGCGGAGACGTCTGCGGTGACGGAGACTCACAAGGGTGCCGAGGCGCCTAGAGACTCACCCGGAGAA
GCCGAGGCTCCAAAGGAAACAGAGACGACCGGTTCACCGGAGGCTACTAAGGAGACGGCTACGGCAGCAGAAGCC
GAAGCACCTGCGGAGATCAAGGCAGAGGAGGCTACCAAGGACGCTGCCGCAGAGATGACGACTCCCGCAGAGGCG
GCGGCGGTGTCTGGGGAAGCCGAAGCTCCTAAGGAGGTGAAGGCGGAAGCGCAAAAGGAAGATGCTACCGCGGAG
ACGGAGGCACCGACGGAAGACGCTCCCGAGGCGGCGGCGGCAGCGTCAGAGGAAGCGAAGGCTTCCGAGGAGGCG
GAAGCGGAGGCTCCCAAAGACGACGCTCCCGCGGAGGCTGGAGATCAACTTGTCGAGGAAGCGGCCCCCAAGGCA
GCGGCCGAGAGCGCAGAGTCCGCAGAGCCGGCCGAAGAGAAGGACGCAGAGCCGGAGGCTGAGCCGGAAAGCGAA
GCCAAGACGGAGCCAGCCGAGGAGGCGCCGGCGCCCGACGCTGACGAGGTCGCGGCGCAGGTGAATGGCGATGAC
GGACAAGCCCAGGACGAAGCCAAACTGTCGACCGAGGAAGAGGGGGCTCCAGCTACCGAGGAGGCAGCAGCAGCG
GATGCTCAGATCAAAGAGGCGGCCGAAGACACAGAAAAAGCAGCCCCCACTGAGGCCGAGACAGATGGAGTGTCC
GCCGCCGGAGCTGCTGCAGCGGTGGCAGGGGCGGGAGCAGCAGCGGCAGTAGCAGCAGCAGCAGCAGCAGCAGCA
GCCAAAGTGCACGATGCGGCAGAAGAGGGTGATGCTGAGCCTTCAACTCCACCACGGCATGTGGCGGAAGAAGAA
GAAGAAGAAGAAGAAGCCGGGCCTCCACTGCCCCCCCGCCATGATGCGGCGGTAGAAGAATCCGGGCCTCGGCTT
CCACCACGGGACAGCGATGCGGTGGTGGAGGAAGAAGAGAGCAAGGACACGGTTGGGCCCATTCCCAAGGCCAAG
GGCGAGGCTATGACAAGATTGAAAAGAGGTAAGGAACACAGTTCTTTCAGTGATGCTCTATTTCCTTTGTCGGAA
GCGTCTTCAGGGTCCAGGCTCTGTCAACAAGGTGGCGACAGAGCGTCGGACTTTAAGGAGCAAGAGTCGATTGTG
AAGGCTGGCAACAACGACTTTGTGATGCAGGCTCCGAAGCCGATGGAGGCCAAGCGCATTGGGAAGCAAGTTCAG
CCGCTCCAAGGGGGGCAAATATCGGAAAAGGAGTTGCTCGGATGGCAAACGAAAGAGGTTATCAAAGGCATATCA
GAGGGTTCGGAACAAAGAGCAAAATCTTCTACCAATGCCTTCTTGAGGCCAGCTCCGGAAGGGCTTCCTGATGAG
TCTCAGTCGCCGGCGGAAGATGAAGACACCTTGGAGCAGATCGGATCGGACACGGCCACTGCTGGCGACGCGCAA
GACATTGCACCTGGCTCATCTCAAGAGCTGCACTACGGACAAAGTCTGGTGATGGAGTCAATCGGGGCTGCTGCA
GCTTTGGGGTTCGCTCTCATGGCACTGGGAGGCACATCGCTGGAGGGACAAGCTTCCGAGCCCAGCGTCGAGGCC
GGCCAGGCACTTCCTCTACTGGCGACCTGCGAGGAGACCTCTGAAGCCGCAACACCTGATATCGAGATACCCGAC
ACGGCAATGATTCAGCTCGATCGGAACAGCAGAGCGGGGCGCAAAAGGGGTCTAGCTCTCCGTGATGCGGAAGAG
ACGGTGGCGGCAGCCGTCGTCATCTACGCAGCAGCAGAAGCACTGAGTCGTCCAAGCCCGGTCTCGGACGCGCTG
GAAGACAGAGGCATAGGCGATGGTTCCCAGCAGATGGATTCGGACCGGGACAGTAAGCGGGAGACGGGTCATTCG
AGCGCCGACAAAGACAAGGAAGGACATCGGAAACGGCTCTCACATCACTCGAGCCGAAGCGGCGGAGACGAGGCA
GCCAAGGAGAACCGACGACGTTCGTCGCACAACTCCCATTCGTCATCTCGGCGCCCTCGCCAAGACAGCGAGAGC
TCGAACCAGGCCAGGGCAGCCGGCAAGCGACACGACAGCGGGCACTCGGGAGAGAGCTCCGGAAGCTCGGGCAGG
AGACGGCGCAATGCAGATGAACAAGCGGATCACGACAGGGAGAAGGCCGAGCGACGGAGGGCCGCGAACGAGCAA
GCGGAGCAGGAGAAGCGAAGGGCCGAGCGACGGCGAAACGCGGACGAGCAGGAGAGGAGAAAGAGCGAGCGTCGA
CACAAGGACAAGGAGGCGACGCGGGGCGAGCAGTCGAACGTGGTGCACAAGACCAGGGAGGCAGAGAGGGCCAAA
GAGGCAGAGGGCCAGCCGGAGCGTAGCCAGCGATCATCGCGGCGACACAGCCACTCGAGCAGTCAGCAACCGCGA
CCGGAGGGGGCGCCAGAGAAGCGCTTCTTTGACGTGCGCAATTCCGAGGGCATCGTGGGACGGGGACCACCGACG
CCGCCCATGACGAGCGAATCGGGCCAGCCGTCTCCGACTCCGCATGGGCCTCGGCGATCGAGCACATCGCACTCC
AAGCACAGCAACGGGCGGCAGTCGAGCGACCAGCCGCGCGCCAAGTCGACCAGGTCGCGGGAGAGCAACGGCTCC
GACGAGAACGGCGGGCCGAGCCGACAGCCGGCGACGGAGGACGGGGCGCGACAGGCGCGACGACACAAGCGCAAT
GGCATGAATGAGCGGGAGGAGCGGAAAAGGGTCAGAGAGGAAGAGAAGAAGGCGGGGGGGATTCGTGGGCTGATG
AAGAGATTGTTTACTTCGTCGTCGTAG
Gene >Ophio5|6778
ATGGCTTCCGGCCCGGGTGTCCAATACTGTCCGTATCGGACTAATCTTGACTTGTCCAACGTGCAATACGCCGAC
TATTCTAATGTTCGATACTACCAGCAGGCTCCTGATTCTGATGAGGAGCAGGTCAACGACGACAATCATGGTGGG
TTGATACACGATATCGAGTTGCGTGCTGGCCTTGACGAGTAGACAGACTTGAACGAATCCGCCGCTGGGGAGCCC
AGTCACCCGAGTCAACCGCAATCACCCGTCAGTGTCCACTCCTCCAACAAAGGGCAACCGAAGTCGGCGAAAGAT
AAGCGAAAGGAGAGAAGAAAGACCAAACAGAAGCCCTCATCACCCACTGCACAAGATGGCCGGAAGCAAGCGGAT
GAAGCGAGTGAGGACGAATCGAGTCCGAAGATTGCCAAGGACAAGAAGCACCAACAACCTTCATCACCAACTGCT
CGAGAGGCTCAAAAGCAGCCTGTAGAAGCGGGCGACGAGGCGAAAGCCGTCAACAAGAAGGGTAAACCCCAGAAG
AAAAAGAGGAAGCAGGCCAAAGGCCAGGCTTCCGCAACTGAGCAAAAGACAACAACAGCCGCCTCCGCACATGAT
GGCAAAGAAGCGAAGAGTCCGACGACATCGGACGCCGCGGAACCCTCTAGCCCTGAAACGGCCACTGCATCTTCT
GAGGGAAAGGCTGGTGACCATGTCGACACCGTGTCCCCCGCTGAGGGTGGCCAGGAAGCGGCTGCCGCAGATAAA
ACTGAGCCCGCCGATGCGGATAAACAGGATGCGAGTGCGGAGGCCTCGGGAGAACAGGCCGCCGCTTCGGCTGAA
GAGCCTTCAGCGCCGACCGAGGAGCCCACAGCGCCTAAAGTTGAGCCAGAGCCAACTGAAGCTGCCGACGAGCCG
TCAGTCGAAGAGCCCGCACAACCTGCAGACTGTACTCCTACCGAGGAGCCTGTGTCAATATCCCAAGTGCCGGAA
GAACCGACTGCTGATGACGACAAGAACGACGCCGAGGGGGTGAAAGAGGACGCACCCGCAGAGCCATCAGCTGAT
CCCGAAACCAAACCGGGAGAAAGCCCAGAGCCACCCGTCACCACCGAAGACGAGTCGAAGCCGAAAGCGGAAGCC
GCCTCGACGGCAGAAGCGACCGGAGAAAAGCAAGGCGAGACGGGCGACGCATCTGCAGATGCATCCGAGGAGCCC
GCTGCCACCGCGGCTCCTTCGGGCGATGCAGCCGAAGACACTGCTACTACCGAGGTCGAGAAAGAAGGGAGTCAG
GAGGCTCCAGCAGACAATCGGGCGGAAGCGGAAGCGGAAGCGGAAGCGAAGACGGAGACGCACTCGGAGTCCCCT
CAGGCCAGCGAGGAGCCTACGACAGCTCAGGCTAAGGAGACTGCAACCGAGGAGGCCATGACCAAGGAGTCTGCT
GCCGGGGGAAGCAAAGCCGACGATACCGAAGCTGAAAAGACTACAGCTGAGGGAAGCAAAGACGAGAACACCGCA
GCCGAGGAGACCAAGGCCGAGGGAAGCACAGCTGAAGACGCCAAAGCCGAGGAGACGGACAGCAAGTCTGAAACT
CCTATAGCTGAAGAAAGCAAAGCCGGAGAGACCAAGGCTATGGAGACTCAAACAGCGGAGGGCAGGGCTGAGGAA
ACTAAAGCCGGCGAGGATCCTACCGAGCAGCCTGAGGCCGAAGTGACTACAGCCGCGAAGGCCGTGGCGGAAGAG
ACGACGCCTGAGGAAACCCAGGCTGAAAAGACACAGACTGAAGAAAACACAGCTGCTGAGACAAAGGTCGGAGAG
TCTCCCCCGGAAGGAAAGTCTGAAGATACTACGGCTAAGGATACCAAGACTGGACAGTCTGTGTCTGAGGAAAAG
TCCGAAGAAATAACGGACAAGGAGACCAAGGATAAAGAGACTACGCCCGAGAAAAGTCCAGCTAAAGAGACCCAG
ACTGAAGAGACAACTGAAGAGACAAAGGGTTCGGCCGAAAACACTCAAGGTCACTCAGAGACCGAGGACCAAAAG
GGAATTGCCGGCACAGCGCAGCGGAAAGAAACAGAAGCCGAAACGGATAATGAGAAGATTGAGGAATCAACGCCC
GACAAATCGACATCAGACGAAACAGAAAAGACGACAGCAGACCAGATCGACATAAAGGAGCCCGCTTCGTCCACA
GAACTTGAAGCTGAGCAGGTTGACAATCAAGCTGCCACCTCAGTTGATGGGGCGCAGGCCGAGGCCGCAGAGAAG
AAAGGTGAAGAAACTGAGCGGTCGACCGACGAGCAACCAAAACCCCCTACGGAACAAAAGTCAGCCGACGAGACC
AACGGGGCTGTCACCCAACCAGACGACGTAGCGAAGGGCGCCGAGAAGAAAGCCGACGACGGTGTTGCTGTGTCT
TCCAATACAGGGGCCCCATCGATTACCTCTCCCTCCAAGCAGGTTCACTTTGCCGAGAAAGATGAGAACATTCCT
CTTGTAACCGATGCTCATTCGGAAGATGGTGAAGGCCCTAACGCGGAGGAAACTAAGCCCGAGGATACTTCAGAC
CATCGCATGGATGCTCCAACACAAGCACCAGATACGAAAGACACAACTGAAGACACCGAAACCGCATCAGCCCAG
GATGTCCCTGTAGATGAAGTCGAGACTACGGGGCAAGGGAACGCCGATAACGCAGGAGAAGCTTCTGCTAAGGCT
GATCATGATGGAGAATCGGAAGAAAAGCGAAACGATGTGTCTGAACCCGAGACTACCGTTGCCTCGGAGGCAGAA
TCAGAGCAGCTGAAGTCTGGAGAGTCCGACGGCGATAAGCCAGCTGAGTCTAGTGAGGATTCGAAAGAAGACGAG
TCCGCTACCGCCCAAGCTGGAGATGGTCCCGCCGGGGAGGCCACCGAGAAAGGCGAGGGTTCTGACGACAAAGCT
GATGAACAAGCGACTCGGGATCAAGACGCCATTTCCGATGCAGCTGGGGAGCCTGAGAGTGCGCCTGGGCCGGAT
GCTCCCGCTTCTGAGGCAGTAAAGCCAGAGAAGAACAGTGCTGCCGAGGAGGAGAAATCCACCCCGGATTCGAAG
GAAGGTGCAGCGCCCGGCGTAGTGACCCAGGAGAAAGAAAAGGGCGTCGACGAGGTGACGGAGACTGCTCCCAAC
GACGGCCCGGAAACAGAGGCAAGCGTTGTGTTGAATACCGAGCCTACCGGCGCCGACGCTGCGGCCGAAACGAAT
GAAGATGGACACCAGTCTACCGAAGAGTCTCCTCAATCCTCTGAAGATACTGCTGCAGGGGCGCCGGATGAATCC
AAAGACGAGCCGGCATCCTCCAAAGACACTGACACGGAGGCGGCCGCAGATGGCGAAGTCGATGCTGCCTCCCCT
AAGGCCGGCAATGAGAAGGAGCCCTCTGGTGAAACTGGAACCCAAGCAGGGACCGAAGAGCCGATGGTAGCAACC
GATGAGCCAAAAGAACCGTCTTCGACGGAAACGGACACTGTCGCCGATGTGCCAAAGGATGCCGAGAAAGACGAC
ACGGCTGCTGCCGCTGAAGCCGAGGCAGCCGAGGTTAGAAAAGAGACTGAAGCTCCAGTGGAAGCCGTGCCTTCG
GTGACAGAGGCTTCTGCAGAGCCGGAGACTGCTACCGAGGCCGAGGCATCCAAAGAGGCACCGGCGCCCGAGACT
GTCCAGGACTCTGAGGGGGGGCAAACGACTGAAAAACCGGACGCCACTGAGGAGGCTGAAGCCCGCGAGGAAGTG
GATGCTTCTCAAGAGGCCGAAGCAGTCAAGAAAGAAGCTTTTGCTGAAGCCGAGGCGCCCAAGGAAGAAGCCTCT
ACTGAGACAGAGGCTCCAAAAGAGCCAGATGCTCCTTTAGGGGTGGAGGCCTCAACGGGTGAAGCGCCCGCTGAG
GCCAAGGAATCCGAGAAAGAGGCTTCCGCAGAGACTGTGGCAGAATCGCCCAAGGAGCCTGAAGCTGCTACGGAG
GCGAAGACAGAAGCACCCGAGGAGCCTGACGTTTCTACGGAGGCGGAAGCGGAGACGCCCAAGGAGCCTGGGGCA
CCTACGGAGACGGAGGCGGAAGTGCCTAAAGAGTCTGAGGCTTCCACGAAAGTAGAAGCAGAAGCGCCTAAGGAG
CCTGACGCACCTGCGGACGCTGAGGCATCCAAGCAACCCGAAGCTCCCACGGAGACTGAAGCAGTGGCACCTAAG
GAGCCTGAAGCACCTACGGAGGCTCAGGCATCCAAGCAACCCGAAGCTTCCAGTAAGACGGAAGCAGTAGCGCCT
GAGGAACCCGAAGCACCCACGAAGCCTGTAGCTTCCACCGTGACGGAAGTGGCAGAGGAACAGCAGGCCTCAAAA
GAAGAACCCTCTACTGAGGCCGAGGCTCCCGCTGACGCGGAGGTGCCAAAGGAAGCCGAGGCGGAGACGTCTGCG
GTGACGGAGACTCACAAGGGTGCCGAGGCGCCTAGAGACTCACCCGGAGAAGCCGAGGCTCCAAAGGAAACAGAG
ACGACCGGTTCACCGGAGGCTACTAAGGAGACGGCTACGGCAGCAGAAGCCGAAGCACCTGCGGAGATCAAGGCA
GAGGAGGCTACCAAGGACGCTGCCGCAGAGATGACGACTCCCGCAGAGGCGGCGGCGGTGTCTGGGGAAGCCGAA
GCTCCTAAGGAGGTGAAGGCGGAAGCGCAAAAGGAAGATGCTACCGCGGAGACGGAGGCACCGACGGAAGACGCT
CCCGAGGCGGCGGCGGCAGCGTCAGAGGAAGCGAAGGCTTCCGAGGAGGCGGAAGCGGAGGCTCCCAAAGACGAC
GCTCCCGCGGAGGCTGGAGATCAACTTGTCGAGGAAGCGGCCCCCAAGGCAGCGGCCGAGAGCGCAGAGTCCGCA
GAGCCGGCCGAAGAGAAGGACGCAGAGCCGGAGGCTGAGCCGGAAAGCGAAGCCAAGACGGAGCCAGCCGAGGAG
GCGCCGGCGCCCGACGCTGACGAGGTCGCGGCGCAGGTGAATGGCGATGACGGACAAGCCCAGGACGAAGCCAAA
CTGTCGACCGAGGAAGAGGGGGCTCCAGCTACCGAGGAGGCAGCAGCAGCGGATGCTCAGATCAAAGAGGCGGCC
GAAGACACAGAAAAAGCAGCCCCCACTGAGGCCGAGACAGATGGAGTGTCCGCCGCCGGAGCTGCTGCAGCGGTG
GCAGGGGCGGGAGCAGCAGCGGCAGTAGCAGCAGCAGCAGCAGCAGCAGCAGCCAAAGTGCACGATGCGGCAGAA
GAGGGTGATGCTGAGCCTTCAACTCCACCACGGCATGTGGCGGAAGAAGAAGAAGAAGAAGAAGAAGCCGGGCCT
CCACTGCCCCCCCGCCATGATGCGGCGGTAGAAGAATCCGGGCCTCGGCTTCCACCACGGGACAGCGATGCGGTG
GTGGAGGAAGAAGAGAGCAAGGACACGGTTGGGCCCATTCCCAAGGCCAAGGGCGAGGCTATGACAAGATTGAAA
AGAGGTAAGGAACACAGTTCTTTCAGTGATGCTCTATTTCCTTTGTCGGAAGCGTCTTCAGGGTCCAGGCTCTGT
CAACAAGGTGGCGACAGAGCGTCGGACTTTAAGGAGCAAGAGTCGATTGTGAAGGCTGGCAACAACGACTTTGTG
ATGCAGGCTCCGAAGCCGATGGAGGCCAAGCGCATTGGGAAGCAAGTTCAGCCGCTCCAAGGGGGGCAAATATCG
GAAAAGGAGTTGCTCGGATGGCAAACGAAAGAGGTTATCAAAGGCATATCAGAGGGTTCGGAACAAAGAGCAAAA
TCTTCTACCAATGCCTTCTTGAGGCCAGCTCCGGAAGGGCTTCCTGATGAGTCTCAGTCGCCGGCGGAAGATGAA
GACACCTTGGAGCAGATCGGATCGGACACGGCCACTGCTGGCGACGCGCAAGACATTGCACCTGGCTCATCTCAA
GAGCTGCACTACGGACAAAGTCTGGTGATGGAGTCAATCGGGGCTGCTGCAGCTTTGGGGTTCGCTCTCATGGCA
CTGGGAGGCACATCGCTGGAGGGACAAGCTTCCGAGCCCAGCGTCGAGGCCGGCCAGGCACTTCCTCTACTGGCG
ACCTGCGAGGAGACCTCTGAAGCCGCAACACCTGATATCGAGATACCCGACACGGCAATGATTCAGCTCGATCGG
AACAGCAGAGCGGGGCGCAAAAGGGGTCTAGCTCTCCGTGATGCGGAAGAGACGGTGGCGGCAGCCGTCGTCATC
TACGCAGCAGCAGAAGCACTGAGTCGTCCAAGCCCGGTCTCGGACGCGCTGGAAGACAGAGGCATAGGCGATGGT
TCCCAGCAGATGGATTCGGACCGGGGTAGCACTTACCATAAGAGAGAGCCGGAGGATGACGAGCGTGATCGATTT
GCTGACTCTCTTTTCCAGACAGTAAGCGGGAGACGGGTCATTCGAGCGCCGACAAAGACAAGGAAGGACATCGGA
AACGGCTCTCACATCACTCGAGCCGAAGCGGCGGAGACGAGGCAGCCAAGGAGAACCGACGACGTTCGTCGCACA
ACTCCCATTCGTCATCTCGGCGCCCTCGCCAAGACAGCGAGAGCTCGAACCAGGCCAGGGCAGCCGGCAAGCGAC
ACGACAGCGGGCACTCGGGAGAGAGCTCCGGAAGCTCGGGCAGGAGACGGCGCAATGCAGATGAACAAGCGGATC
ACGACAGGGAGAAGGCCGAGCGACGGAGGGCCGCGAACGAGCAAGCGGAGCAGGAGAAGCGAAGGGCCGAGCGAC
GGCGAAACGCGGACGAGCAGGAGAGGAGAAAGAGCGAGCGTCGACACAAGGACAAGGAGGCGACGCGGGGCGAGC
AGTCGAACGTGGTGCACAAGACCAGGGAGGCAGAGAGGGCCAAAGAGGCAGAGGGCCAGCCGGAGCGTAGCCAGC
GATCATCGCGGCGACACAGCCACTCGAGCAGTCAGCAACCGCGACCGGAGGGGGCGCCAGAGAAGCGCTTCTTTG
ACGTGCGCAATTCCGAGGGCATCGTGGGACGGGGACCACCGACGCCGCCCATGACGAGCGAATCGGGCCAGCCGT
CTCCGACTCCGCATGGGCCTCGGCGATCGAGCACATCGCACTCCAAGCACAGCAACGGGCGGCAGTCGAGCGACC
AGCCGCGCGCCAAGTCGACCAGGTCGCGGGAGAGCAACGGCTCCGACGAGAACGGCGGGCCGAGCCGACAGCCGG
CGACGGAGGACGGGGCGCGACAGGCGCGACGACACAAGCGCAATGGCATGAATGAGCGGGAGGAGCGGAAAAGGG
TCAGAGAGGAAGAGAAGAAGGCGGGGGGGATTCGTGGGCTGATGAAGAGATTGTTTACTTCGTCGTCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail