Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6760
Gene name
Locationscaffold_607:5979..6993
Strand-
Gene length (bp)1014
Transcript length (bp)864
Coding sequence length (bp)861
Protein length (aa) 287

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00756 Esterase Putative esterase 3.2E-50 23 276

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9GJT2|ESTD_PIG S-formylglutathione hydrolase OS=Sus scrofa GN=ESD PE=2 SV=1 1 284 3.0E-93
sp|P10768|ESTD_HUMAN S-formylglutathione hydrolase OS=Homo sapiens GN=ESD PE=1 SV=2 1 284 4.0E-93
sp|Q9R0P3|ESTD_MOUSE S-formylglutathione hydrolase OS=Mus musculus GN=Esd PE=1 SV=1 1 284 5.0E-93
sp|B0BNE5|ESTD_RAT S-formylglutathione hydrolase OS=Rattus norvegicus GN=Esd PE=2 SV=1 1 284 2.0E-92
sp|Q08E20|ESTD_BOVIN S-formylglutathione hydrolase OS=Bos taurus GN=ESD PE=2 SV=1 1 284 8.0E-89
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9GJT2|ESTD_PIG S-formylglutathione hydrolase OS=Sus scrofa GN=ESD PE=2 SV=1 1 284 3.0E-93
sp|P10768|ESTD_HUMAN S-formylglutathione hydrolase OS=Homo sapiens GN=ESD PE=1 SV=2 1 284 4.0E-93
sp|Q9R0P3|ESTD_MOUSE S-formylglutathione hydrolase OS=Mus musculus GN=Esd PE=1 SV=1 1 284 5.0E-93
sp|B0BNE5|ESTD_RAT S-formylglutathione hydrolase OS=Rattus norvegicus GN=Esd PE=2 SV=1 1 284 2.0E-92
sp|Q08E20|ESTD_BOVIN S-formylglutathione hydrolase OS=Bos taurus GN=ESD PE=2 SV=1 1 284 8.0E-89
sp|Q8LAS8|SFGH_ARATH S-formylglutathione hydrolase OS=Arabidopsis thaliana GN=SFGH PE=1 SV=2 12 286 1.0E-83
sp|A1AXZ2|SFGH_PARDP S-formylglutathione hydrolase OS=Paracoccus denitrificans (strain Pd 1222) GN=fghA PE=1 SV=1 1 285 1.0E-80
sp|P40363|SFGH_YEAST S-formylglutathione hydrolase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL068C PE=1 SV=1 13 287 2.0E-71
sp|Q8FKG2|SFGH1_ECOL6 S-formylglutathione hydrolase FrmB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=frmB PE=3 SV=1 10 286 6.0E-71
sp|A7ZX03|SFGH1_ECOHS S-formylglutathione hydrolase FrmB OS=Escherichia coli O9:H4 (strain HS) GN=frmB PE=3 SV=1 10 286 6.0E-71
sp|A7ZIA3|SFGH1_ECO24 S-formylglutathione hydrolase FrmB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=frmB PE=3 SV=1 10 286 6.0E-71
sp|Q3Z551|SFGH1_SHISS S-formylglutathione hydrolase FrmB OS=Shigella sonnei (strain Ss046) GN=frmB PE=3 SV=1 10 286 6.0E-71
sp|Q8X5J5|SFGH1_ECO57 S-formylglutathione hydrolase FrmB OS=Escherichia coli O157:H7 GN=frmB PE=3 SV=1 10 286 1.0E-70
sp|Q0TKS8|SFGH1_ECOL5 S-formylglutathione hydrolase FrmB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=frmB PE=3 SV=1 10 286 1.0E-70
sp|Q1RFI8|SFGH1_ECOUT S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain UTI89 / UPEC) GN=frmB PE=3 SV=1 10 286 2.0E-70
sp|A1A834|SFGH1_ECOK1 S-formylglutathione hydrolase FrmB OS=Escherichia coli O1:K1 / APEC GN=frmB PE=3 SV=1 10 286 2.0E-70
sp|B1LIP0|SFGH1_ECOSM S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=frmB PE=3 SV=1 10 286 2.0E-70
sp|B1J086|SFGH1_ECOLC S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=frmB PE=3 SV=1 10 286 6.0E-70
sp|P51025|SFGH1_ECOLI S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain K12) GN=frmB PE=1 SV=2 10 286 2.0E-69
sp|B1XEU8|SFGH1_ECODH S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain K12 / DH10B) GN=frmB PE=3 SV=1 10 286 2.0E-69
sp|Q1R9R8|SFGH2_ECOUT S-formylglutathione hydrolase YeiG OS=Escherichia coli (strain UTI89 / UPEC) GN=yeiG PE=3 SV=1 12 284 1.0E-67
sp|A7ZNX7|SFGH2_ECO24 S-formylglutathione hydrolase YeiG OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=yeiG PE=3 SV=1 11 284 1.0E-67
sp|Q0T2X0|SFGH2_SHIF8 S-formylglutathione hydrolase YeiG OS=Shigella flexneri serotype 5b (strain 8401) GN=yeiG PE=3 SV=1 12 284 1.0E-67
sp|Q3Z052|SFGH2_SHISS S-formylglutathione hydrolase YeiG OS=Shigella sonnei (strain Ss046) GN=yeiG PE=3 SV=1 12 284 1.0E-67
sp|Q0TFT6|SFGH2_ECOL5 S-formylglutathione hydrolase YeiG OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=yeiG PE=3 SV=1 12 284 1.0E-67
sp|Q8FFU3|SFGH2_ECOL6 S-formylglutathione hydrolase YeiG OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=yeiG PE=3 SV=1 12 284 1.0E-67
sp|B1X7P2|SFGH2_ECODH S-formylglutathione hydrolase YeiG OS=Escherichia coli (strain K12 / DH10B) GN=yeiG PE=3 SV=1 12 284 1.0E-67
sp|A8A215|SFGH2_ECOHS S-formylglutathione hydrolase YeiG OS=Escherichia coli O9:H4 (strain HS) GN=yeiG PE=3 SV=1 12 284 1.0E-67
sp|B1IYB5|SFGH2_ECOLC S-formylglutathione hydrolase YeiG OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=yeiG PE=3 SV=1 12 284 1.0E-67
sp|P33018|SFGH2_ECOLI S-formylglutathione hydrolase YeiG OS=Escherichia coli (strain K12) GN=yeiG PE=1 SV=1 12 284 1.0E-67
sp|Q31YW2|SFGH2_SHIBS S-formylglutathione hydrolase YeiG OS=Shigella boydii serotype 4 (strain Sb227) GN=yeiG PE=3 SV=1 12 284 1.0E-67
sp|A1AD14|SFGH2_ECOK1 S-formylglutathione hydrolase YeiG OS=Escherichia coli O1:K1 / APEC GN=yeiG PE=3 SV=1 12 284 1.0E-67
sp|Q8X635|SFGH2_ECO57 S-formylglutathione hydrolase YeiG OS=Escherichia coli O157:H7 GN=yeiG PE=3 SV=1 11 284 2.0E-67
sp|B1LKQ1|SFGH2_ECOSM S-formylglutathione hydrolase YeiG OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=yeiG PE=3 SV=1 11 284 2.0E-67
sp|Q32EQ3|SFGH2_SHIDS S-formylglutathione hydrolase YeiG OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=yeiG PE=3 SV=1 11 284 1.0E-66
sp|P44556|SFGH_HAEIN S-formylglutathione hydrolase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0184 PE=1 SV=1 12 284 1.0E-64
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6760
MAFTTDATIATFGGRLLKLRHQSSSTSTPMELNLFIPPSAKASSPAPLLIYLSGLSCTPNNATEKAALQAHASPL
GLALLFPDTSPRGTDIPGQDEDWDFGVAASFYLDAVVEPWSAHYRMETYLTQELPRLLFDTYPELAKDRVSIAGH
SMGGHGALTLFLRHPGMYRSVSAWSPVANPCLCPWGEKAFRGYLGDDKSRWKEHDATELLKTWDKGSPLNCLIDV
GTNDNFYKQGQLLPENFEKAVKEAGIEGVKVRYHEGYDHSYYFISTFGADHVKHAAKSLGLL
Coding >Ophio5|6760
ATGGCCTTCACCACCGATGCCACCATCGCCACCTTCGGCGGCCGTCTGCTCAAGCTCAGGCATCAGTCCAGCTCG
ACGTCGACGCCGATGGAGCTCAACCTCTTCATCCCGCCCTCGGCCAAGGCCTCGTCCCCGGCCCCTCTCCTCATC
TACCTCTCCGGCCTAAGCTGCACGCCCAACAACGCGACCGAGAAAGCGGCCCTGCAAGCCCATGCCTCACCCCTC
GGACTCGCCCTTCTCTTCCCGGACACGTCCCCGCGCGGGACCGACATCCCCGGCCAAGATGAGGATTGGGACTTT
GGCGTCGCTGCCTCTTTCTATCTGGATGCTGTCGTCGAGCCTTGGTCTGCGCATTATCGGATGGAGACGTATCTT
ACTCAGGAACTGCCTCGTCTGCTCTTCGACACGTACCCGGAGCTAGCAAAGGATCGAGTTTCGATCGCCGGTCAC
TCTATGGGCGGTCATGGCGCTCTGACTCTCTTCTTGCGTCATCCGGGCATGTATCGCAGTGTCAGTGCCTGGTCG
CCCGTCGCGAATCCTTGTCTATGCCCCTGGGGCGAAAAGGCCTTTCGCGGCTATCTTGGCGACGACAAGAGTCGC
TGGAAGGAACATGATGCCACCGAGCTGCTCAAGACTTGGGACAAGGGCTCTCCTCTCAACTGCCTCATCGACGTT
GGCACCAACGACAACTTCTATAAGCAGGGCCAGCTACTACCCGAGAACTTCGAGAAAGCCGTCAAAGAGGCCGGA
ATCGAGGGCGTCAAGGTTCGCTACCACGAGGGATACGACCATTCCTACTACTTCATCTCCACATTCGGGGCAGAT
CATGTCAAGCACGCGGCCAAATCTCTCGGCCTGTTG
Transcript >Ophio5|6760
ATGGCCTTCACCACCGATGCCACCATCGCCACCTTCGGCGGCCGTCTGCTCAAGCTCAGGCATCAGTCCAGCTCG
ACGTCGACGCCGATGGAGCTCAACCTCTTCATCCCGCCCTCGGCCAAGGCCTCGTCCCCGGCCCCTCTCCTCATC
TACCTCTCCGGCCTAAGCTGCACGCCCAACAACGCGACCGAGAAAGCGGCCCTGCAAGCCCATGCCTCACCCCTC
GGACTCGCCCTTCTCTTCCCGGACACGTCCCCGCGCGGGACCGACATCCCCGGCCAAGATGAGGATTGGGACTTT
GGCGTCGCTGCCTCTTTCTATCTGGATGCTGTCGTCGAGCCTTGGTCTGCGCATTATCGGATGGAGACGTATCTT
ACTCAGGAACTGCCTCGTCTGCTCTTCGACACGTACCCGGAGCTAGCAAAGGATCGAGTTTCGATCGCCGGTCAC
TCTATGGGCGGTCATGGCGCTCTGACTCTCTTCTTGCGTCATCCGGGCATGTATCGCAGTGTCAGTGCCTGGTCG
CCCGTCGCGAATCCTTGTCTATGCCCCTGGGGCGAAAAGGCCTTTCGCGGCTATCTTGGCGACGACAAGAGTCGC
TGGAAGGAACATGATGCCACCGAGCTGCTCAAGACTTGGGACAAGGGCTCTCCTCTCAACTGCCTCATCGACGTT
GGCACCAACGACAACTTCTATAAGCAGGGCCAGCTACTACCCGAGAACTTCGAGAAAGCCGTCAAAGAGGCCGGA
ATCGAGGGCGTCAAGGTTCGCTACCACGAGGGATACGACCATTCCTACTACTTCATCTCCACATTCGGGGCAGAT
CATGTCAAGCACGCGGCCAAATCTCTCGGCCTGTTGTAA
Gene >Ophio5|6760
ATGGCCTTCACCACCGATGCCACCATCGCCACCTTCGGCGGCCGTCTGCTCAAGCTCAGGCATCAGTCCAGCTCG
ACGTCGACGCCGATGGAGCTCAACCTCTTCATCCCGCCCTCGGCCAAGGCCTCGTCCCCGGCCCCTCTCCTCATC
TACCTCTCCGGCCTAAGCTGCACGCCCAACAACGCGACCGAGAAAGCGGCCCTGCAAGCCCATGCCTCACCCCTC
GGACTCGCCCTTCTCTTCCCGGACACGTCCCCGCGCGGGACCGACATCCCCGGCCAAGATGAGGATTGGGACTTT
GGCGTCGCTGCCTCTTTCTATCTGGATGCTGTCGTCGAGCCTTGGTCTGCGCATTATCGGATGGAGACGTATCTT
ACTCAGGAACTGCCTCGTCTGCTCTTCGACACGTACCCGGAGCTAGCAAAGGATCGAGTTTCGATCGCCGGTCAC
TCTATGGGCGGTCATGGCGCTCTGACTCTCTTCTTGCGTCATCCGGGCATGTATCGCAGTGTCAGTGCCTGGTCG
CCCGTCGCGAATCCTTGTCTATGCCCCTGGGGCGAAAAGGCCTTTCGCGGCTATCTTGGCGACGACAAGAGTCGC
TGGAAGGAACATGATGCCACCGAGCTGCTCAAGACTTGGGACAAGGGCTCTCCTCTCAACTGCCTCATCGACGTT
GTCTGTTCCTCCACCTCTTTTTTTTTTCTCTTCGTACCGACCATCGTCCCGCTGACCAGACGACTTCGCTCGCTG
CAGGGCACCAACGACAACTTCTATAAGCAGGGCCAGCTACTACCCGAGAACTTCGAGAAAGCCGTCAAAGAGGCC
GGAATCGAGGGCGTCAAGGTTCGCTACCACGAGGTGAGTCTATACTACTCGATCCTTGGAGAACAGCCCCAGAAA
ACAAATGGCCTGACCCTTTCCCCTTTCAAGGGATACGACCATTCCTACTACTTCATCTCCACATTCGGGGCAGAT
CATGTCAAGCACGCGGCCAAATCTCTCGGCCTGTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail