Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6757
Gene name
Locationscaffold_606:8338..10837
Strand-
Gene length (bp)2499
Transcript length (bp)2220
Coding sequence length (bp)2217
Protein length (aa) 739

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02558 ApbA Ketopantoate reductase PanE/ApbA 1.3E-26 9 166
PF08546 ApbA_C Ketopantoate reductase PanE/ApbA C terminal 5.3E-23 199 322

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7P6|MUG72_SCHPO Meiotically up-regulated gene 72 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug72 PE=1 SV=1 2 326 2.0E-70
sp|Q09894|YAI7_SCHPO Uncharacterized protein C24B11.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.07c PE=1 SV=1 7 344 6.0E-33
sp|Q03088|SVL3_YEAST Styryl dye vacuolar localization protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SVL3 PE=1 SV=1 7 331 5.0E-16
sp|Q07589|YD144_YEAST Uncharacterized protein YDL144C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL144C PE=1 SV=2 9 339 3.0E-10
sp|Q9HRF0|PANE_HALSA Putative 2-dehydropantoate 2-reductase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_0730C PE=3 SV=1 87 319 7.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6757
MDDSQLMNICTVGGNPVSAFLSWRLQATNACDVTLVWKSGFEHVAQYGISFKSPIFGNERFKPRHVVQNPEDAST
ARDGPFDYVVLCVKALPDVYDLAAVIDSVVAPHHTCILINTTHTLGVEAAIEERYPTNIVLSLVSGAELTQLGPS
EFEHKGSTELWVGPANRNSSIPHSIQEDMAQALAMTLSTGQVQCKVSPNIRQHQYERVIGPIAFHPVSVIFETPN
HAALFEKVGVKDLVSEVIDELLRLAEATGCKFSSEFKQRTMDEMTKPNLPESIMWQDYVARRPMEVETFLGSPIK
LARDNRVSVPRIETLYALLHNVNTMNRNRPKAGEATAQLPPPGPMPPGTPTMASPLPRAPSHQSHRPMLSGVPNG
NGMPPPRQPRPRNSANFPPGGHSGGHPGGMRRPPPMNGPPPAGFPRPPPSVNGGGSRAASRRNSMEGNDLEEFSH
LVLYDDIPEGQEPTFSSGEADLALRERELQLRQRELALREQEMRMRRGPPPGPRRGPHPGPHPAPHPMRNSHQAF
DDDDDDDEFFDPAASTGGTTPTIDPDNFDMMSVTSRKTRKAPGPSAAQFRRNPEFDAPVPPRGGGGRFRPHFGRS
RPNHGGHAPAMTDNLLDDPMMSFTSNRYATVDRGAMGASSRANSLTASRLDELQYSHGGPPGMNGAYPRRASQSP
GNPYASSVRGGGGRPSPPNGFGPPMNGRPSPPDGVRQPVPRYPSGQGNSVAPQRVEQHVGRGQW
Coding >Ophio5|6757
ATGGACGACAGTCAACTAATGAACATTTGCACAGTTGGTGGGAACCCCGTCTCAGCCTTTTTGTCGTGGAGGCTT
CAGGCCACCAACGCCTGCGATGTCACTTTGGTCTGGAAATCGGGGTTTGAGCATGTTGCCCAGTACGGCATCTCT
TTCAAGTCGCCCATCTTTGGCAACGAGAGATTCAAGCCTCGACATGTGGTACAGAACCCCGAAGACGCCTCGACC
GCACGCGATGGCCCGTTCGACTATGTCGTCCTCTGCGTAAAAGCCCTGCCCGACGTCTACGATCTCGCCGCCGTC
ATCGACTCCGTCGTTGCTCCCCATCACACATGCATTCTCATAAATACGACGCACACTCTCGGCGTCGAGGCGGCC
ATCGAGGAGCGCTACCCCACAAACATTGTGCTTTCGCTCGTCTCCGGCGCCGAGTTGACGCAGCTCGGCCCGAGT
GAGTTCGAGCACAAGGGCTCGACGGAGCTATGGGTCGGACCGGCCAACAGAAACAGCAGTATACCGCATTCGATT
CAGGAGGACATGGCCCAGGCTTTGGCAATGACGCTGAGTACGGGCCAGGTGCAGTGCAAGGTCTCTCCGAATATC
CGCCAGCATCAGTACGAGAGGGTCATCGGGCCCATCGCTTTCCACCCCGTCAGTGTCATCTTCGAGACACCGAAT
CATGCGGCTCTTTTCGAAAAGGTTGGCGTCAAGGACCTGGTATCCGAGGTCATCGACGAGTTGCTGCGCCTCGCC
GAGGCGACAGGCTGCAAGTTCTCCTCGGAATTCAAGCAGCGCACCATGGACGAGATGACCAAGCCCAACCTCCCG
GAAAGCATCATGTGGCAGGACTACGTGGCGAGACGGCCCATGGAGGTTGAGACGTTTCTTGGGTCCCCCATCAAG
TTGGCCCGCGACAACCGCGTCTCGGTGCCGAGGATCGAGACGCTATATGCTCTCCTCCACAACGTCAATACCATG
AACCGAAACCGGCCCAAGGCCGGAGAGGCGACGGCGCAACTGCCGCCGCCAGGCCCCATGCCCCCCGGCACGCCC
ACCATGGCGTCTCCCTTACCGCGGGCGCCCTCGCACCAGAGCCACCGTCCCATGCTGAGCGGCGTGCCCAACGGC
AACGGCATGCCTCCGCCACGTCAGCCGCGTCCGAGGAACTCGGCCAACTTCCCCCCGGGAGGTCACTCCGGTGGC
CACCCCGGAGGGATGCGTCGCCCGCCACCCATGAACGGGCCTCCGCCAGCCGGATTTCCCCGCCCGCCGCCATCG
GTCAATGGTGGAGGTTCGAGGGCAGCGTCGCGGAGAAACTCGATGGAGGGCAACGACCTCGAGGAGTTTTCGCAC
CTGGTGTTGTACGACGACATTCCCGAGGGCCAGGAGCCGACCTTTTCTTCCGGTGAGGCTGATCTCGCCCTCCGC
GAGCGGGAACTGCAGCTGCGTCAGCGTGAGCTGGCCTTGCGAGAGCAGGAGATGCGAATGAGGCGAGGCCCTCCC
CCTGGGCCACGGCGCGGACCGCACCCTGGACCGCACCCCGCACCGCACCCCATGCGTAATAGCCATCAGGCATTT
GACGACGATGACGACGATGACGAGTTTTTTGATCCCGCCGCTTCCACGGGCGGCACCACCCCGACCATCGACCCC
GACAACTTTGACATGATGAGCGTCACGTCGAGGAAGACGCGCAAAGCGCCAGGCCCTTCGGCCGCTCAGTTCCGC
CGAAACCCAGAGTTTGACGCGCCCGTCCCGCCTCGGGGAGGAGGAGGCAGGTTTCGGCCCCACTTCGGTCGCAGC
CGTCCGAACCACGGCGGTCATGCGCCCGCTATGACGGATAACCTCCTCGACGACCCCATGATGTCGTTTACGTCC
AACCGCTACGCAACCGTCGACCGTGGGGCAATGGGGGCCAGTTCCCGGGCCAACTCGCTGACGGCATCGAGACTG
GACGAGCTGCAGTACAGTCACGGCGGTCCGCCCGGCATGAACGGGGCCTACCCTCGGCGGGCCAGCCAGTCCCCG
GGAAACCCGTACGCCTCGTCGGTACGCGGCGGCGGAGGCCGGCCGTCTCCTCCAAACGGATTCGGCCCGCCGATG
AACGGGCGACCCTCTCCCCCGGATGGTGTTCGACAGCCTGTACCGCGCTATCCATCTGGTCAGGGTAACTCGGTG
GCTCCACAGCGCGTTGAGCAGCACGTCGGGCGCGGGCAGTGG
Transcript >Ophio5|6757
ATGGACGACAGTCAACTAATGAACATTTGCACAGTTGGTGGGAACCCCGTCTCAGCCTTTTTGTCGTGGAGGCTT
CAGGCCACCAACGCCTGCGATGTCACTTTGGTCTGGAAATCGGGGTTTGAGCATGTTGCCCAGTACGGCATCTCT
TTCAAGTCGCCCATCTTTGGCAACGAGAGATTCAAGCCTCGACATGTGGTACAGAACCCCGAAGACGCCTCGACC
GCACGCGATGGCCCGTTCGACTATGTCGTCCTCTGCGTAAAAGCCCTGCCCGACGTCTACGATCTCGCCGCCGTC
ATCGACTCCGTCGTTGCTCCCCATCACACATGCATTCTCATAAATACGACGCACACTCTCGGCGTCGAGGCGGCC
ATCGAGGAGCGCTACCCCACAAACATTGTGCTTTCGCTCGTCTCCGGCGCCGAGTTGACGCAGCTCGGCCCGAGT
GAGTTCGAGCACAAGGGCTCGACGGAGCTATGGGTCGGACCGGCCAACAGAAACAGCAGTATACCGCATTCGATT
CAGGAGGACATGGCCCAGGCTTTGGCAATGACGCTGAGTACGGGCCAGGTGCAGTGCAAGGTCTCTCCGAATATC
CGCCAGCATCAGTACGAGAGGGTCATCGGGCCCATCGCTTTCCACCCCGTCAGTGTCATCTTCGAGACACCGAAT
CATGCGGCTCTTTTCGAAAAGGTTGGCGTCAAGGACCTGGTATCCGAGGTCATCGACGAGTTGCTGCGCCTCGCC
GAGGCGACAGGCTGCAAGTTCTCCTCGGAATTCAAGCAGCGCACCATGGACGAGATGACCAAGCCCAACCTCCCG
GAAAGCATCATGTGGCAGGACTACGTGGCGAGACGGCCCATGGAGGTTGAGACGTTTCTTGGGTCCCCCATCAAG
TTGGCCCGCGACAACCGCGTCTCGGTGCCGAGGATCGAGACGCTATATGCTCTCCTCCACAACGTCAATACCATG
AACCGAAACCGGCCCAAGGCCGGAGAGGCGACGGCGCAACTGCCGCCGCCAGGCCCCATGCCCCCCGGCACGCCC
ACCATGGCGTCTCCCTTACCGCGGGCGCCCTCGCACCAGAGCCACCGTCCCATGCTGAGCGGCGTGCCCAACGGC
AACGGCATGCCTCCGCCACGTCAGCCGCGTCCGAGGAACTCGGCCAACTTCCCCCCGGGAGGTCACTCCGGTGGC
CACCCCGGAGGGATGCGTCGCCCGCCACCCATGAACGGGCCTCCGCCAGCCGGATTTCCCCGCCCGCCGCCATCG
GTCAATGGTGGAGGTTCGAGGGCAGCGTCGCGGAGAAACTCGATGGAGGGCAACGACCTCGAGGAGTTTTCGCAC
CTGGTGTTGTACGACGACATTCCCGAGGGCCAGGAGCCGACCTTTTCTTCCGGTGAGGCTGATCTCGCCCTCCGC
GAGCGGGAACTGCAGCTGCGTCAGCGTGAGCTGGCCTTGCGAGAGCAGGAGATGCGAATGAGGCGAGGCCCTCCC
CCTGGGCCACGGCGCGGACCGCACCCTGGACCGCACCCCGCACCGCACCCCATGCGTAATAGCCATCAGGCATTT
GACGACGATGACGACGATGACGAGTTTTTTGATCCCGCCGCTTCCACGGGCGGCACCACCCCGACCATCGACCCC
GACAACTTTGACATGATGAGCGTCACGTCGAGGAAGACGCGCAAAGCGCCAGGCCCTTCGGCCGCTCAGTTCCGC
CGAAACCCAGAGTTTGACGCGCCCGTCCCGCCTCGGGGAGGAGGAGGCAGGTTTCGGCCCCACTTCGGTCGCAGC
CGTCCGAACCACGGCGGTCATGCGCCCGCTATGACGGATAACCTCCTCGACGACCCCATGATGTCGTTTACGTCC
AACCGCTACGCAACCGTCGACCGTGGGGCAATGGGGGCCAGTTCCCGGGCCAACTCGCTGACGGCATCGAGACTG
GACGAGCTGCAGTACAGTCACGGCGGTCCGCCCGGCATGAACGGGGCCTACCCTCGGCGGGCCAGCCAGTCCCCG
GGAAACCCGTACGCCTCGTCGGTACGCGGCGGCGGAGGCCGGCCGTCTCCTCCAAACGGATTCGGCCCGCCGATG
AACGGGCGACCCTCTCCCCCGGATGGTGTTCGACAGCCTGTACCGCGCTATCCATCTGGTCAGGGTAACTCGGTG
GCTCCACAGCGCGTTGAGCAGCACGTCGGGCGCGGGCAGTGGTGA
Gene >Ophio5|6757
ATGGACGACAGTCAACTAATGAACATTTGCACAGTTGGTGGGAACCCCGTCTCAGCCTTTTTGTCGTGGAGGCTT
CAGGCCACCAACGCCTGCGATGTCACTTTGGTCTGGAAATCGGGGTTTGAGCATGTTGCCCAGTACGGCATCTCT
TTCAAGTAAGCTCCCCCCCCCCTTCCGCCTTCTCCTGTATCCGTGGCTTTCTGGAGCCATGTTGCTTTACCGATC
CGCAGCTTGCTGACCCCAACACCTCTGCCAGGTCGCCCATCTTTGGCAACGAGAGATTCAAGCCTCGACATGGTG
CGTGCTCTAGTCGAGCTCGCGGCGACGACTTGCTGACGTGTCCAACAGTGGTACAGAACCCCGAAGACGCCTCGA
CCGCACGCGATGGCCCGTTCGACTATGTCGTCCTCTGCGTAAAAGCCCTGCCCGACGTCTACGATCTCGCCGCCG
TCATCGACTCCGTCGTTGCTCCCCATCACACATGCATTCTCATAAATACGACGCACACTCTCGGCGTCGAGGCGG
CCATCGAGGAGCGCTACCCCACAAACATTGTGCTTTCGCTCGTCTCCGGCGCCGAGTTGACGCAGCTCGGCCCGA
GTGAGTTCGAGCACAAGGGCTCGACGGAGCTATGGGTCGGACCGGCCAACAGAAACAGCAGTATACCGCATTCGA
TTCAGGAGGACATGGCCCAGGCTTTGGCAATGACGCTGAGTACGGGCCAGGTGCAGTGCAAGGTCTCTCCGAATA
TCCGCCAGCATCAGTACGAGAGGGTCATCGGGTGAGTTCTACCGCTGTCGCCCGGCCGTGATCCGCGAAACCCAC
TGACCTCGGTTTGCTCAGGCCCATCGCTTTCCACCCCGTCAGTGTCATCTTCGAGACACCGAATCATGCGGCTCT
TTTCGAAAAGGTTGGCGTCAAGGACCTGGTATCCGAGGTCATCGACGAGTTGCTGCGCCTCGCCGAGGCGACAGG
CTGCAAGTTCTCCTCGGAATTCAAGCAGCGCACCATGGACGAGATGACCAAGCCCAACCTCCCGGAAAGCATCAT
GTGGCAGGACTACGTGGCGAGACGGCCCATGGAGGTTGAGACGTTTCTTGGGTCCCCCATCAAGTTGGCCCGCGA
CAACCGCGTCTCGGTGCCGAGGATCGAGACGCTATATGCTCTCCTCCACAACGTCAATACCATGAACCGAAACCG
GCCCAAGGCCGGAGAGGCGACGGCGCAACTGCCGCCGCCAGGCCCCATGCCCCCCGGCACGCCCACCATGGCGTC
TCCCTTACCGCGGGCGCCCTCGCACCAGAGCCACCGTCCCATGCTGAGCGGCGTGCCCAACGGCAACGGCATGCC
TCCGCCACGTCAGCCGCGTCCGAGGAACTCGGCCAACTTCCCCCCGGGAGGTCACTCCGGTGGCCACCCCGGAGG
GATGCGTCGCCCGCCACCCATGAACGGGCCTCCGCCAGCCGGATTTCCCCGCCCGCCGCCATCGGTCAATGGTGG
AGGTTCGAGGGCAGCGTCGCGGAGAAACTCGATGGAGGGCAACGACCTCGAGGAGTTTTCGCACCTGGTGTTGTA
CGACGACATTCCCGAGGGCCAGGAGCCGACCTTTTCTTCCGGTGAGGCTGATCTCGCCCTCCGCGAGCGGGAACT
GCAGCTGCGTCAGCGTGAGCTGGCCTTGCGAGAGCAGGAGATGCGAATGAGGCGAGGCCCTCCCCCTGGGCCACG
GCGCGGACCGCACCCTGGACCGCACCCCGCACCGCACCCCATGCGTAATAGCCATCAGGCATTTGACGACGATGA
CGACGATGACGAGTTTTTTGATCCCGCCGCTTCCACGGGCGGCACCACCCCGACCATCGACCCCGACAACTTTGA
CATGATGAGCGTCACGTCGAGGAAGACGCGCAAAGCGCCAGGCCCTTCGGCCGCTCAGTTCCGCCGAAACCCAGA
GTTTGACGCGCCCGTCCCGCCTCGGGGAGGAGGAGGCAGGTTTCGGCCCCACTTCGGTCGCAGCCGTCCGAACCA
CGGCGGTCATGCGCCCGCTATGACGGATAACCTCCTCGACGACCCCATGATGTCGTTTACGTCCAACCGCTACGC
AACCGTCGACCGTGGGGCAATGGGGGCCAGTTCCCGGGCCAACTCGCTGACGGCATCGAGACTGGACGAGCTGCA
GTACAGTCACGGCGGTCCGCCCGGCATGAACGGGGCCTACCCTCGGCGGGCCAGCCAGTCCCCGGGAAACCCGTA
CGCCTCGTCGGTACGCGGCGGCGGAGGCCGGCCGTCTCCTCCAAACGGATTCGGCCCGCCGATGAACGGGCGACC
CTCTCCCCCGGATGGTGTTCGACAGCCTGTACCGCGCTATCCATCTGGTCAGGGTAACTCGGTGGCTCCACAGCG
CGTTGAGCAGCACGTCGGGGTGAGCGCACTTCGTCCACCAAAGCCGAGAAACGTTCGCAGTCTGACGGGAAGCGC
GAGCGTTAGCGCGGGCAGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail