Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6756
Gene name
Locationscaffold_606:6427..6853
Strand-
Gene length (bp)426
Transcript length (bp)267
Coding sequence length (bp)264
Protein length (aa) 88

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08227 DASH_Hsk3 DASH complex subunit Hsk3 like 1.4E-20 27 70

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94483|HOS3_SCHPO High osmolarity sensitivity protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hos3 PE=1 SV=1 24 87 1.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6756
MATRNVNATQNLDQRQSVMGGGMVKTRQLTHLHSQLAQLSANLADTENLLRMTSVQAEAMKGLGSWHAGLFMAAS
KVLGEESVREGGR
Coding >Ophio5|6756
ATGGCGACGCGCAATGTCAATGCTACGCAGAATCTGGATCAGCGACAGAGTGTGATGGGCGGGGGAATGGTGAAG
ACGCGGCAGCTGACACACCTCCACTCGCAGCTGGCGCAGCTGTCTGCCAACCTTGCGGACACGGAGAACCTACTG
CGGATGACGAGCGTGCAGGCCGAGGCGATGAAGGGGCTCGGCAGCTGGCATGCTGGTCTTTTTATGGCTGCGAGT
AAGGTGCTAGGCGAGGAGAGCGTTAGGGAGGGTGGGAGA
Transcript >Ophio5|6756
ATGGCGACGCGCAATGTCAATGCTACGCAGAATCTGGATCAGCGACAGAGTGTGATGGGCGGGGGAATGGTGAAG
ACGCGGCAGCTGACACACCTCCACTCGCAGCTGGCGCAGCTGTCTGCCAACCTTGCGGACACGGAGAACCTACTG
CGGATGACGAGCGTGCAGGCCGAGGCGATGAAGGGGCTCGGCAGCTGGCATGCTGGTCTTTTTATGGCTGCGAGT
AAGGTGCTAGGCGAGGAGAGCGTTAGGGAGGGTGGGAGATGA
Gene >Ophio5|6756
ATGGCGACGCGCAATGTCAATGCTACGCAGAATCTGGATCAGCGACAGAGTGTGATGGGCGGGGGAATGGTGAAG
ACGCGGCAGCTGGTAGGTCCTCCATTGTTGTCTGCAGCACTCAGACAACTTGTTTGTTCTCTTCTTCTCTCTTGG
CTCTAGCTAACGCCCAGTCCACCTTCCCCAGACACACCTCCACTCGCAGCTGGCGCAGCTGTCTGCCAACCTTGC
GGACACGGAGAACCTACTGCGGATGACGAGCGTGCAGGCCGAGGCGATGAAGGGGCTCGGCAGCTGGCATGCTGG
TCTGTGAGTGTCGTCTCTCTGTTGTACCCCCTCACTCTTGTTGGTCAGGAGTCGGCTGACGGTGGTAGTTTTATG
GCTGCGAGTAAGGTGCTAGGCGAGGAGAGCGTTAGGGAGGGTGGGAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail