Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6733
Gene name
Locationscaffold_601:117..3202
Strand-
Gene length (bp)3085
Transcript length (bp)2856
Coding sequence length (bp)2853
Protein length (aa) 951

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04191 PEMT Phospholipid methyltransferase 6.9E-21 215 314
PF04191 PEMT Phospholipid methyltransferase 2.7E-33 485 588

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BBC6|CHO2_EMENI Phosphatidylethanolamine N-methyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cho2 PE=3 SV=1 3 929 0.0E+00
sp|C1GZK1|CHO2_PARBA Phosphatidylethanolamine N-methyltransferase OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=CHO2 PE=3 SV=2 15 943 0.0E+00
sp|C0NLX2|CHO2_AJECG Phosphatidylethanolamine N-methyltransferase OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CHO2 PE=3 SV=1 6 945 0.0E+00
sp|B8MBN3|CHO2_TALSN Phosphatidylethanolamine N-methyltransferase OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=cho2 PE=3 SV=1 32 947 0.0E+00
sp|C5JCV0|CHO2_AJEDS Phosphatidylethanolamine N-methyltransferase OS=Ajellomyces dermatitidis (strain SLH14081) GN=CHO2 PE=3 SV=1 32 943 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BBC6|CHO2_EMENI Phosphatidylethanolamine N-methyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cho2 PE=3 SV=1 3 929 0.0E+00
sp|C1GZK1|CHO2_PARBA Phosphatidylethanolamine N-methyltransferase OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=CHO2 PE=3 SV=2 15 943 0.0E+00
sp|C0NLX2|CHO2_AJECG Phosphatidylethanolamine N-methyltransferase OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CHO2 PE=3 SV=1 6 945 0.0E+00
sp|B8MBN3|CHO2_TALSN Phosphatidylethanolamine N-methyltransferase OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=cho2 PE=3 SV=1 32 947 0.0E+00
sp|C5JCV0|CHO2_AJEDS Phosphatidylethanolamine N-methyltransferase OS=Ajellomyces dermatitidis (strain SLH14081) GN=CHO2 PE=3 SV=1 32 943 0.0E+00
sp|C5GN10|CHO2_AJEDR Phosphatidylethanolamine N-methyltransferase OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=CHO2 PE=3 SV=1 32 943 0.0E+00
sp|Q4WZS1|CHO2_ASPFU Phosphatidylethanolamine N-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cho2 PE=3 SV=1 24 899 0.0E+00
sp|B0XUW3|CHO2_ASPFC Phosphatidylethanolamine N-methyltransferase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cho2 PE=3 SV=1 24 899 0.0E+00
sp|C6H4B5|CHO2_AJECH Phosphatidylethanolamine N-methyltransferase OS=Ajellomyces capsulatus (strain H143) GN=CHO2 PE=3 SV=1 6 945 0.0E+00
sp|D4DGR3|CHO2_TRIVH Phosphatidylethanolamine N-methyltransferase OS=Trichophyton verrucosum (strain HKI 0517) GN=CHO2 PE=3 SV=1 35 943 0.0E+00
sp|D1ZIW5|CHO2_SORMK Phosphatidylethanolamine N-methyltransferase OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=CHO2 PE=3 SV=1 14 943 0.0E+00
sp|C5FZ62|CHO2_ARTOC Phosphatidylethanolamine N-methyltransferase OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=CHO2 PE=3 SV=1 30 937 0.0E+00
sp|Q0U2R3|CHO2_PHANO Phosphatidylethanolamine N-methyltransferase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CHO2 PE=3 SV=2 32 946 0.0E+00
sp|D4AT37|CHO2_ARTBC Phosphatidylethanolamine N-methyltransferase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CHO2 PE=3 SV=1 35 943 0.0E+00
sp|Q6C6U9|CHO2_YARLI Phosphatidylethanolamine N-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CHO2 PE=3 SV=1 37 929 0.0E+00
sp|B6JWP7|CHO2_SCHJY Phosphatidylethanolamine N-methyltransferase OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=cho2 PE=3 SV=1 15 942 0.0E+00
sp|O74787|CHO2_SCHPO Phosphatidylethanolamine N-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cho2 PE=1 SV=1 2 932 0.0E+00
sp|B2WFD4|CHO2_PYRTR Phosphatidylethanolamine N-methyltransferase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=cho2 PE=3 SV=1 391 943 0.0E+00
sp|B0D4E6|CHO2_LACBS Phosphatidylethanolamine N-methyltransferase OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=CHO2 PE=3 SV=1 3 933 0.0E+00
sp|B6QG32|CHO2_TALMQ Phosphatidylethanolamine N-methyltransferase OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=cho2 PE=3 SV=1 33 947 0.0E+00
sp|C7Z7C3|CHO2_NECH7 Phosphatidylethanolamine N-methyltransferase OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=CHO2 PE=3 SV=1 34 947 0.0E+00
sp|C1G565|CHO2_PARBD Phosphatidylethanolamine N-methyltransferase OS=Paracoccidioides brasiliensis (strain Pb18) GN=CHO2 PE=3 SV=1 23 943 0.0E+00
sp|Q7SAJ6|CHO2_NEUCR Phosphatidylethanolamine N-methyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chol-1 PE=3 SV=1 33 943 0.0E+00
sp|Q2H0U8|CHO2_CHAGB Phosphatidylethanolamine N-methyltransferase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHO2 PE=3 SV=1 9 947 0.0E+00
sp|A4RHN5|CHO2_MAGO7 Phosphatidylethanolamine N-methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHO2 PE=3 SV=1 21 943 0.0E+00
sp|A6S950|CHO2_BOTFB Phosphatidylethanolamine N-methyltransferase OS=Botryotinia fuckeliana (strain B05.10) GN=CHO2 PE=3 SV=1 7 943 0.0E+00
sp|Q2UDE5|CHO2_ASPOR Phosphatidylethanolamine N-methyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cho2 PE=3 SV=1 2 947 0.0E+00
sp|B8N6H2|CHO2_ASPFN Phosphatidylethanolamine N-methyltransferase OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=cho2 PE=3 SV=1 2 947 0.0E+00
sp|C5PEI5|CHO2_COCP7 Phosphatidylethanolamine N-methyltransferase OS=Coccidioides posadasii (strain C735) GN=CHO2 PE=3 SV=1 17 947 0.0E+00
sp|B2B2N5|CHO2_PODAN Phosphatidylethanolamine N-methyltransferase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CHO2 PE=3 SV=1 33 943 0.0E+00
sp|A2R616|CHO2_ASPNC Phosphatidylethanolamine N-methyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cho2 PE=3 SV=1 25 943 0.0E+00
sp|B6HJA3|CHO2_PENRW Phosphatidylethanolamine N-methyltransferase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=cho2 PE=3 SV=1 28 943 0.0E+00
sp|A1DIF7|CHO2_NEOFI Phosphatidylethanolamine N-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=CHO2 PE=3 SV=1 24 943 0.0E+00
sp|Q0CVD7|CHO2_ASPTN Phosphatidylethanolamine N-methyltransferase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cho2 PE=3 SV=1 14 935 0.0E+00
sp|C4JDF8|CHO2_UNCRE Phosphatidylethanolamine N-methyltransferase OS=Uncinocarpus reesii (strain UAMH 1704) GN=CHO2 PE=3 SV=1 12 947 0.0E+00
sp|A1C7T5|CHO2_ASPCL Phosphatidylethanolamine N-methyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cho2 PE=3 SV=1 28 947 0.0E+00
sp|C0RZV6|CHO2_PARBP Phosphatidylethanolamine N-methyltransferase OS=Paracoccidioides brasiliensis (strain Pb03) GN=CHO2 PE=3 SV=2 23 943 0.0E+00
sp|Q6BY28|CHO2_DEBHA Phosphatidylethanolamine N-methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CHO2 PE=3 SV=2 37 936 6.0E-139
sp|A5DL79|CHO2_PICGU Phosphatidylethanolamine N-methyltransferase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=CHO2 PE=3 SV=2 37 933 3.0E-133
sp|B2WFD4|CHO2_PYRTR Phosphatidylethanolamine N-methyltransferase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=cho2 PE=3 SV=1 11 323 5.0E-132
sp|A8PRN6|CHO2_MALGO Phosphatidylethanolamine N-methyltransferase OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=CHO2 PE=3 SV=1 18 930 8.0E-127
sp|Q59LV5|CHO2_CANAL Phosphatidylethanolamine N-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHO2 PE=3 SV=1 23 858 1.0E-126
sp|C5DGB6|CHO2_LACTC Phosphatidylethanolamine N-methyltransferase OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=CHO2 PE=3 SV=1 15 896 3.0E-126
sp|A3LQW6|CHO2_PICST Phosphatidylethanolamine N-methyltransferase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=CHO2 PE=3 SV=2 37 827 1.0E-125
sp|C4YL78|CHO2_CANAW Phosphatidylethanolamine N-methyltransferase OS=Candida albicans (strain WO-1) GN=CHO2 PE=3 SV=1 23 858 2.0E-125
sp|A7TLA7|CHO22_VANPO Phosphatidylethanolamine N-methyltransferase 2 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CHO2-2 PE=3 SV=1 31 830 1.0E-124
sp|A5DS78|CHO2_LODEL Phosphatidylethanolamine N-methyltransferase OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=CHO2 PE=3 SV=1 37 874 2.0E-123
sp|B9WL59|CHO2_CANDC Phosphatidylethanolamine N-methyltransferase OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=CHO2 PE=3 SV=1 23 824 4.0E-123
sp|C5M4D4|CHO2_CANTT Phosphatidylethanolamine N-methyltransferase OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=CHO2 PE=3 SV=1 37 824 1.0E-119
sp|C4QXE9|CHO2_PICPG Phosphatidylethanolamine N-methyltransferase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=CHO2 PE=3 SV=1 32 929 4.0E-119
sp|Q6FVB6|CHO2_CANGA Phosphatidylethanolamine N-methyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CHO2 PE=3 SV=1 25 839 2.0E-118
sp|Q754G0|CHO2_ASHGO Phosphatidylethanolamine N-methyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CHO2 PE=3 SV=1 42 899 1.0E-116
sp|B5VJA0|CHO2_YEAS6 Phosphatidylethanolamine N-methyltransferase OS=Saccharomyces cerevisiae (strain AWRI1631) GN=CHO2 PE=3 SV=1 30 827 1.0E-114
sp|C8Z951|CHO2_YEAS8 Phosphatidylethanolamine N-methyltransferase OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=CHO2 PE=3 SV=1 30 827 1.0E-114
sp|B3LI73|CHO2_YEAS1 Phosphatidylethanolamine N-methyltransferase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=CHO2 PE=3 SV=1 30 827 1.0E-114
sp|A6ZUG8|CHO2_YEAS7 Phosphatidylethanolamine N-methyltransferase OS=Saccharomyces cerevisiae (strain YJM789) GN=CHO2 PE=3 SV=1 30 827 1.0E-114
sp|C7GQ65|CHO2_YEAS2 Phosphatidylethanolamine N-methyltransferase OS=Saccharomyces cerevisiae (strain JAY291) GN=CHO2 PE=3 SV=1 30 827 1.0E-114
sp|P05374|CHO2_YEAST Phosphatidylethanolamine N-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHO2 PE=1 SV=1 30 827 6.0E-114
sp|C5DZU3|CHO2_ZYGRC Phosphatidylethanolamine N-methyltransferase OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=CHO2 PE=3 SV=1 42 824 3.0E-112
sp|C4Y206|CHO2_CLAL4 Phosphatidylethanolamine N-methyltransferase OS=Clavispora lusitaniae (strain ATCC 42720) GN=CHO2 PE=3 SV=1 37 827 1.0E-111
sp|Q6CJI9|CHO2_KLULA Phosphatidylethanolamine N-methyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CHO2 PE=3 SV=1 1 832 8.0E-111
sp|A7TNI7|CHO21_VANPO Phosphatidylethanolamine N-methyltransferase 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CHO2-1 PE=3 SV=1 29 591 9.0E-106
sp|C4YL78|CHO2_CANAW Phosphatidylethanolamine N-methyltransferase OS=Candida albicans (strain WO-1) GN=CHO2 PE=3 SV=1 339 662 3.0E-19
sp|A7TNI7|CHO21_VANPO Phosphatidylethanolamine N-methyltransferase 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CHO2-1 PE=3 SV=1 717 892 1.0E-13
sp|B2WFD4|CHO2_PYRTR Phosphatidylethanolamine N-methyltransferase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=cho2 PE=3 SV=1 148 326 1.0E-12
sp|B2WFD4|CHO2_PYRTR Phosphatidylethanolamine N-methyltransferase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=cho2 PE=3 SV=1 334 587 2.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

Domain # Start End Length
1 69 88 19
2 93 115 22
3 179 201 22
4 205 227 22
5 271 293 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6733
MTTALESAQLRRRLKAPDDADPETARPDVKGKKKTFGRTPDGTVFVVPTTHDMVSQLLDPRKPKNLADLIVLGFL
ALHILAAWLLPAGWKRPVFAFVFLGWRASYNFGIGVLLHVQSHHGRLITWARRWKLFEDPRTGDNPRPWLYGLLK
RELEAKITEDYVFEEAPIEYNSWLVFRRLVDLILMCDFVSYCLFAIVCGHVPKGEGLLMGVGRWSLGIALVGFNL
WVKLDAHRVVKDFAWYWGDFFYLIDQDLTFDGVFELAPHPMYSIGYAGYYGISMMAASYEVLFISIVAHMAQFAF
LVAVENPHIEKTYNPPPPRLRALSRCQSDPTVLLAGPEDDDEDEEATTDRPLVAESPAAVHDMVGLGNMDLFRVP
DLAVVTLPLYMALVTLATPSTPPWQAVFVAHALAWRVWYHLGLGIVLDQQSKTKMWTRHFLKFGESAGEAWRQWK
GMQHFCMIVCNASFMAACWKMYSAPEDWGDGLVLLRHVVGASLVALQLWTAFSVYGSLGEFGWFCGDFFFDQEAK
LTYTSIYRFLNSPERIFGTAGVWGAALITWSRPIFIMAIVTQILSLYYLSFIERPHMQKIYGRSLRGEAGLTKFI
KRSLPPPVKVWQESMDRVLDDTTHFVEEFIETARPKFASGVKTIVRDTSALFNMAPARLTITRIAPDLTGLDPKQ
YGLSVSGTPSVQSPTRGRATGKESLSGRFPKAVKTMAFEYGSPLRVRWRAPAEHSKRDWIGLYMVTDNRSREATE
VSSLGRWAPTNEGIYDSLTADSSIATAEHSAGDDMVEGEVLFEGDKLWWTQGVYEFRYHHDGKHTVMAVSEPFET
AIAPFAEDEAAAAEGSSSSAVQARAVEAAILPVIQRCLDRDPDIAPNTVDEPFGGHVERDGKYARRIVYAIREMF
GVEFAPAVVLADRNARKLAWRICNAKEVLAPYSLSHSRGTTTPATRESVVA
Coding >Ophio5|6733
ATGACGACTGCCTTGGAGTCCGCCCAGTTGCGCCGCCGGCTCAAGGCCCCTGATGATGCTGATCCCGAGACAGCC
CGGCCGGATGTCAAGGGCAAGAAGAAGACGTTTGGCCGGACCCCGGACGGAACGGTCTTCGTCGTCCCCACCACG
CATGACATGGTCTCGCAGCTCCTCGATCCCCGGAAGCCCAAGAACCTGGCCGATCTCATCGTCCTCGGCTTTCTG
GCACTGCACATACTCGCCGCCTGGCTGCTGCCGGCCGGTTGGAAGCGGCCCGTCTTTGCCTTCGTCTTCCTCGGC
TGGAGGGCGTCGTACAACTTCGGCATCGGCGTCTTGCTGCACGTCCAGTCTCACCATGGTCGCCTCATCACCTGG
GCTCGGCGCTGGAAGCTGTTTGAGGATCCGCGGACGGGCGACAATCCCCGGCCGTGGCTGTACGGGCTGCTGAAG
CGGGAGCTCGAGGCCAAGATCACCGAAGACTACGTTTTTGAGGAGGCCCCCATCGAGTACAACAGCTGGCTGGTC
TTTCGCAGGCTGGTCGACCTGATTCTCATGTGCGACTTTGTGTCGTACTGCCTCTTCGCCATTGTCTGCGGCCAC
GTGCCCAAGGGCGAGGGCCTCTTGATGGGCGTCGGCCGCTGGTCTCTGGGCATCGCCCTCGTTGGCTTCAACTTG
TGGGTCAAGCTCGACGCCCACCGGGTCGTCAAGGACTTTGCCTGGTACTGGGGCGACTTCTTCTATCTCATCGAC
CAGGACCTGACCTTTGACGGCGTCTTCGAGTTGGCGCCGCATCCCATGTACTCGATCGGCTATGCCGGCTACTAC
GGCATCTCCATGATGGCCGCCAGCTACGAGGTGCTCTTCATCTCCATCGTCGCCCACATGGCCCAGTTCGCCTTC
CTGGTGGCGGTGGAGAATCCTCACATCGAAAAGACATACAACCCGCCGCCGCCGCGGCTGAGGGCCCTGTCGCGC
TGCCAGAGCGATCCTACCGTGCTGCTGGCCGGGCCCGAGGATGACGATGAGGACGAGGAGGCGACGACGGACCGG
CCCCTGGTGGCGGAGTCGCCGGCGGCGGTGCACGACATGGTCGGCCTCGGCAACATGGACCTGTTCCGGGTGCCG
GACCTGGCCGTGGTGACGCTGCCGCTGTACATGGCCCTCGTCACGCTGGCGACGCCGTCGACGCCGCCTTGGCAG
GCCGTCTTCGTGGCCCACGCCCTGGCCTGGCGCGTCTGGTACCACCTGGGGCTGGGCATCGTCCTGGACCAGCAG
TCCAAGACCAAGATGTGGACGCGGCACTTTCTCAAGTTTGGCGAGAGCGCGGGCGAGGCGTGGCGTCAGTGGAAG
GGCATGCAGCACTTTTGCATGATCGTGTGCAACGCCTCCTTCATGGCCGCCTGCTGGAAGATGTACTCGGCCCCT
GAGGACTGGGGCGACGGCCTGGTGCTCCTGCGGCACGTCGTCGGCGCCTCGCTGGTGGCGCTGCAGCTCTGGACG
GCCTTTAGCGTCTACGGCTCTCTCGGCGAGTTTGGCTGGTTCTGCGGCGACTTCTTCTTCGACCAAGAGGCGAAG
CTGACGTACACGTCCATCTATCGCTTCCTCAACAGCCCGGAGCGCATCTTCGGCACGGCCGGCGTCTGGGGCGCG
GCCCTGATAACGTGGAGCCGGCCCATCTTCATCATGGCCATTGTCACCCAGATCCTGTCGCTGTACTACCTGTCC
TTCATCGAGCGGCCGCACATGCAAAAGATTTACGGCCGGAGCCTGAGGGGGGAGGCCGGGCTCACCAAGTTCATC
AAGCGGTCGCTGCCGCCGCCCGTCAAGGTCTGGCAGGAGAGCATGGACAGGGTGCTGGACGACACGACGCACTTT
GTCGAGGAATTCATCGAGACGGCGCGGCCCAAGTTCGCGTCGGGCGTCAAGACGATCGTGCGCGACACGTCGGCC
CTCTTCAACATGGCGCCGGCGCGTCTGACCATTACGCGCATCGCGCCGGACCTGACGGGCCTGGACCCCAAGCAG
TACGGCCTGTCGGTGTCGGGCACGCCGTCGGTCCAGTCGCCGACGCGTGGGCGGGCCACGGGCAAGGAGAGCCTG
AGCGGCCGGTTCCCCAAGGCGGTCAAGACGATGGCGTTCGAGTACGGGTCCCCGCTGCGGGTGCGGTGGCGAGCT
CCGGCCGAGCACAGCAAGCGGGACTGGATCGGCCTCTACATGGTGACGGACAACCGGTCCCGGGAGGCGACCGAG
GTTTCGTCTCTGGGCCGATGGGCGCCGACCAACGAGGGCATCTACGACTCGCTGACGGCCGACAGCAGCATCGCG
ACGGCCGAGCACAGCGCGGGCGACGACATGGTCGAGGGCGAGGTTCTGTTCGAAGGCGACAAGCTCTGGTGGACG
CAGGGCGTGTACGAGTTCCGCTACCACCACGACGGCAAGCACACCGTCATGGCCGTATCGGAGCCGTTCGAGACG
GCCATTGCGCCCTTTGCCGAGGACGAGGCGGCGGCGGCCGAGGGGTCGTCGTCCTCGGCCGTCCAGGCGCGGGCC
GTCGAGGCAGCCATCCTGCCCGTCATCCAGCGCTGTCTCGACCGGGATCCGGACATTGCGCCTAACACGGTGGAC
GAGCCGTTTGGCGGCCACGTGGAGCGGGACGGAAAGTACGCGAGGCGCATCGTCTACGCCATCCGCGAGATGTTC
GGAGTCGAGTTTGCGCCGGCGGTGGTGCTGGCGGACCGAAATGCGCGGAAGCTTGCCTGGCGCATCTGCAACGCC
AAGGAGGTTCTGGCTCCCTACAGCTTGTCTCATTCGAGGGGTACGACGACGCCAGCGACGCGCGAGTCGGTCGTG
GCT
Transcript >Ophio5|6733
ATGACGACTGCCTTGGAGTCCGCCCAGTTGCGCCGCCGGCTCAAGGCCCCTGATGATGCTGATCCCGAGACAGCC
CGGCCGGATGTCAAGGGCAAGAAGAAGACGTTTGGCCGGACCCCGGACGGAACGGTCTTCGTCGTCCCCACCACG
CATGACATGGTCTCGCAGCTCCTCGATCCCCGGAAGCCCAAGAACCTGGCCGATCTCATCGTCCTCGGCTTTCTG
GCACTGCACATACTCGCCGCCTGGCTGCTGCCGGCCGGTTGGAAGCGGCCCGTCTTTGCCTTCGTCTTCCTCGGC
TGGAGGGCGTCGTACAACTTCGGCATCGGCGTCTTGCTGCACGTCCAGTCTCACCATGGTCGCCTCATCACCTGG
GCTCGGCGCTGGAAGCTGTTTGAGGATCCGCGGACGGGCGACAATCCCCGGCCGTGGCTGTACGGGCTGCTGAAG
CGGGAGCTCGAGGCCAAGATCACCGAAGACTACGTTTTTGAGGAGGCCCCCATCGAGTACAACAGCTGGCTGGTC
TTTCGCAGGCTGGTCGACCTGATTCTCATGTGCGACTTTGTGTCGTACTGCCTCTTCGCCATTGTCTGCGGCCAC
GTGCCCAAGGGCGAGGGCCTCTTGATGGGCGTCGGCCGCTGGTCTCTGGGCATCGCCCTCGTTGGCTTCAACTTG
TGGGTCAAGCTCGACGCCCACCGGGTCGTCAAGGACTTTGCCTGGTACTGGGGCGACTTCTTCTATCTCATCGAC
CAGGACCTGACCTTTGACGGCGTCTTCGAGTTGGCGCCGCATCCCATGTACTCGATCGGCTATGCCGGCTACTAC
GGCATCTCCATGATGGCCGCCAGCTACGAGGTGCTCTTCATCTCCATCGTCGCCCACATGGCCCAGTTCGCCTTC
CTGGTGGCGGTGGAGAATCCTCACATCGAAAAGACATACAACCCGCCGCCGCCGCGGCTGAGGGCCCTGTCGCGC
TGCCAGAGCGATCCTACCGTGCTGCTGGCCGGGCCCGAGGATGACGATGAGGACGAGGAGGCGACGACGGACCGG
CCCCTGGTGGCGGAGTCGCCGGCGGCGGTGCACGACATGGTCGGCCTCGGCAACATGGACCTGTTCCGGGTGCCG
GACCTGGCCGTGGTGACGCTGCCGCTGTACATGGCCCTCGTCACGCTGGCGACGCCGTCGACGCCGCCTTGGCAG
GCCGTCTTCGTGGCCCACGCCCTGGCCTGGCGCGTCTGGTACCACCTGGGGCTGGGCATCGTCCTGGACCAGCAG
TCCAAGACCAAGATGTGGACGCGGCACTTTCTCAAGTTTGGCGAGAGCGCGGGCGAGGCGTGGCGTCAGTGGAAG
GGCATGCAGCACTTTTGCATGATCGTGTGCAACGCCTCCTTCATGGCCGCCTGCTGGAAGATGTACTCGGCCCCT
GAGGACTGGGGCGACGGCCTGGTGCTCCTGCGGCACGTCGTCGGCGCCTCGCTGGTGGCGCTGCAGCTCTGGACG
GCCTTTAGCGTCTACGGCTCTCTCGGCGAGTTTGGCTGGTTCTGCGGCGACTTCTTCTTCGACCAAGAGGCGAAG
CTGACGTACACGTCCATCTATCGCTTCCTCAACAGCCCGGAGCGCATCTTCGGCACGGCCGGCGTCTGGGGCGCG
GCCCTGATAACGTGGAGCCGGCCCATCTTCATCATGGCCATTGTCACCCAGATCCTGTCGCTGTACTACCTGTCC
TTCATCGAGCGGCCGCACATGCAAAAGATTTACGGCCGGAGCCTGAGGGGGGAGGCCGGGCTCACCAAGTTCATC
AAGCGGTCGCTGCCGCCGCCCGTCAAGGTCTGGCAGGAGAGCATGGACAGGGTGCTGGACGACACGACGCACTTT
GTCGAGGAATTCATCGAGACGGCGCGGCCCAAGTTCGCGTCGGGCGTCAAGACGATCGTGCGCGACACGTCGGCC
CTCTTCAACATGGCGCCGGCGCGTCTGACCATTACGCGCATCGCGCCGGACCTGACGGGCCTGGACCCCAAGCAG
TACGGCCTGTCGGTGTCGGGCACGCCGTCGGTCCAGTCGCCGACGCGTGGGCGGGCCACGGGCAAGGAGAGCCTG
AGCGGCCGGTTCCCCAAGGCGGTCAAGACGATGGCGTTCGAGTACGGGTCCCCGCTGCGGGTGCGGTGGCGAGCT
CCGGCCGAGCACAGCAAGCGGGACTGGATCGGCCTCTACATGGTGACGGACAACCGGTCCCGGGAGGCGACCGAG
GTTTCGTCTCTGGGCCGATGGGCGCCGACCAACGAGGGCATCTACGACTCGCTGACGGCCGACAGCAGCATCGCG
ACGGCCGAGCACAGCGCGGGCGACGACATGGTCGAGGGCGAGGTTCTGTTCGAAGGCGACAAGCTCTGGTGGACG
CAGGGCGTGTACGAGTTCCGCTACCACCACGACGGCAAGCACACCGTCATGGCCGTATCGGAGCCGTTCGAGACG
GCCATTGCGCCCTTTGCCGAGGACGAGGCGGCGGCGGCCGAGGGGTCGTCGTCCTCGGCCGTCCAGGCGCGGGCC
GTCGAGGCAGCCATCCTGCCCGTCATCCAGCGCTGTCTCGACCGGGATCCGGACATTGCGCCTAACACGGTGGAC
GAGCCGTTTGGCGGCCACGTGGAGCGGGACGGAAAGTACGCGAGGCGCATCGTCTACGCCATCCGCGAGATGTTC
GGAGTCGAGTTTGCGCCGGCGGTGGTGCTGGCGGACCGAAATGCGCGGAAGCTTGCCTGGCGCATCTGCAACGCC
AAGGAGGTTCTGGCTCCCTACAGCTTGTCTCATTCGAGGGGTACGACGACGCCAGCGACGCGCGAGTCGGTCGTG
GCTTAA
Gene >Ophio5|6733
ATGACGACTGCCTTGGAGTCCGCCCAGTTGCGCCGCCGGCTCAAGGCCCCTGATGATGCTGATCCCGAGACAGCC
CGGCCGGATGTCAAGGGCAAGAAGAAGACGTTTGGCCGGACCCCGGACGGAACGGGTAAGTCGGCCGACGCAATA
ATGATTTTTTTTTTAAAAAAAAACCCCCATGACCGGGGGATTCCCATAGCTGACCCGGCACCGGCAGTCTTCGTC
GTCCCCACCACGCATGACATGGTCTCGCAGCTCCTCGATCCCCGGAAGCCCAAGAACCTGGCCGATCTCATCGTC
CTCGGCTTTCTGGCACTGCACATACTCGCCGCCTGGCTGCTGCCGGCCGGTTGGAAGCGGCCCGTCTTTGCCTTC
GTCTTCCTCGGCTGGAGGGCGTCGTACAACTTCGGCATCGGCGTCTTGCTGCACGTCCAGTCTCACCATGGTCGC
CTCATCACCTGGGCTCGGCGCTGGAAGCTGTTTGAGGATCCGCGGACGGGCGACAATCCCCGGCCGTGGCTGTAC
GGGCTGCTGAAGCGGGAGCTCGAGGCCAAGATCACCGAAGACTACGTTTTTGAGGAGGCCCCCATCGAGTACAAC
AGCTGGCTGGTCTTTCGCAGGCTGGTCGACCTGATTCTCATGTGCGACTTTGTGTCGTACTGCCTCTTCGCCATT
GTCTGCGGCCACGTGCCCAAGGGCGAGGGCCTCTTGATGGGCGTCGGCCGCTGGTCTCTGGGCATCGCCCTCGTT
GGCTTCAACTTGTGGGTCAAGCTCGACGCCCACCGGGTCGTCAAGGACTTTGCCTGGTACTGGGGCGACTTCTTC
TATCTCATCGACCAGGACCTGACCTTTGACGGCGTCTTCGAGTTGGCGCCGCATCCCATGTACTCGATCGGCTAT
GCCGGCTACTACGGCATCTCCATGATGGCCGCCAGCTACGAGGTGCTCTTCATCTCCATCGTCGCCCACATGGCC
CAGTTCGCCTTCCTGGTGGCGGTGGAGAATCCTCACATCGAAAAGACATACAACCCGCCGCCGCCGCGGCTGAGG
GCCCTGTCGCGCTGCCAGAGCGATCCTACCGTGCTGCTGGCCGGGCCCGAGGATGACGATGAGGACGAGGAGGCG
ACGACGGACCGGCCCCTGGTGGCGGAGTCGCCGGCGGCGGTGCACGACATGGTCGGCCTCGGCAACATGGACCTG
TTCCGGGTGCCGGACCTGGCCGTGGTGACGCTGCCGCTGTACATGGCCCTCGTCACGCTGGCGACGCCGTCGACG
CCGCCTTGGCAGGCCGTCTTCGTGGCCCACGCCCTGGCCTGGCGCGTCTGGTACCACCTGGGGCTGGGCATCGTC
CTGGACCAGCAGTCCAAGACCAAGATGTGGACGCGGCACTTTCTCAAGTTTGGCGAGAGCGCGGGCGAGGCGTGG
CGTCAGTGGAAGGGCATGCAGCACTTTTGCATGATCGTGTGCAACGCCTCCTTCATGGCCGCCTGCTGGAAGATG
TACTCGGCCCCTGAGGACTGGGGCGACGGCCTGGTGCTCCTGCGGCACGTCGTCGGCGCCTCGCTGGTGGCGCTG
CAGCTCTGGACGGCCTTTAGCGTCTACGGCTCTCTCGGCGAGTTTGGCTGGTTCTGCGGCGACTTCTTCTTCGAC
CAAGAGGCGAAGCTGACGTACACGTCCATCTATCGCTTCCTCAACAGCCCGGAGCGCATCTTCGGCACGGCCGGC
GTCTGGGGCGCGGCCCTGATAACGTGGAGCCGGCCCATCTTCATCATGGCCATTGTCACCCAGATCCTGTCGCTG
TACTACCTGTCCTTCATCGAGCGGCCGCACATGCAAAAGATTTACGGCCGGAGCCTGAGGGGGGAGGCCGGGCTC
ACCAAGTTCATCAAGCGGTCGCTGCCGCCGCCCGTCAAGGTCTGGCAGGAGAGCATGGACAGGGTGCTGGACGAC
ACGACGCACTTTGTCGAGGAATTCATCGAGACGGCGCGGCCCAAGTTCGCGTCGGGCGTCAAGACGATCGTGCGC
GACACGTCGGCCCTCTTCAACATGGCGCCGGCGCGTCTGACCATTACGCGCATCGCGCCGGACCTGACGGGCCTG
GACCCCAAGCAGTACGGCCTGTCGGTGTCGGGCACGCCGTCGGTCCAGTCGCCGACGCGTGGGCGGGCCACGGGC
AAGGAGAGCCTGAGCGGCCGGTTCCCCAAGGCGGTCAAGACGATGGCGTTCGAGTACGGGTCCCCGCTGCGGGTG
CGGTGGCGAGCTCCGGCCGAGCACAGCAAGCGGGACTGGATCGGCCTCTACATGGTGACGGACAACCGGTCCCGG
GAGGCGACCGAGGTTTCGTCTCTGGGCCGATGGGCGCCGACCAACGAGGGCATCTACGACTCGCTGACGGCCGAC
AGCAGCATCGCGACGGCCGAGCACAGCGCGGGCGACGACATGGTCGAGGGCGAGGTTCTGTTCGAAGGCGACAAG
CTCTGGTGGACGCAGGGCGTGTACGAGTTCCGCTACCACCACGACGGCAAGCACACCGTCATGGCCGTATCGGAG
CCGTTCGAGACGGCCATTGCGCCCTTTGCCGAGGACGAGGCGGCGGCGGCCGAGGGGTCGTCGTCCTCGGCCGTC
CAGGCGCGGGCCGTCGAGGCAGCCATCCTGCCCGTCATCCAGCGCTGTCTCGACCGGGATCCGGACATTGCGCCT
AACACGGTGGACGAGCCGTTTGGCGGCCACGTGGAGCGGGACGGAAAGTACGCGAGGCGCATCGTCTACGCCATC
CGCGAGATGTTCGGAGTCGAGTTTGCGCCGGCGGTGGTGCTGGCGGACCGAAATGCGCGGAAGCTTGCCTGGCGC
ATCTGCAACGCCAAGGAGGTTCTGGTAAGGAAAAAGGCATTAATTCGTCATTTCCATGGAGTAGAATGAATCGCT
AACGCCTCTTTCTCTCTTTTTTCCTCTCCCTTTTTTTTTTCCTCTTTTTTTTTTTTCTTTTCCCTCCCTATTTTC
CCCCCTCACTCCAAAGGCTCCCTACAGCTTGTCTCATTCGAGGGGTACGACGACGCCAGCGACGCGCGAGTCGGT
CGTGGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail