Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6728
Gene name
Locationscaffold_60:44521..46073
Strand-
Gene length (bp)1552
Transcript length (bp)1425
Coding sequence length (bp)1422
Protein length (aa) 474

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04253 TFR_dimer Transferrin receptor-like dimerisation domain 1.4E-21 353 467
PF04389 Peptidase_M28 Peptidase family M28 5.1E-13 79 247

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1R0|GCP1_ARTBC Probable glutamate carboxypeptidase ARB_02390 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02390 PE=1 SV=1 12 468 3.0E-51
sp|Q7M758|NALDL_MOUSE N-acetylated-alpha-linked acidic dipeptidase-like protein OS=Mus musculus GN=Naaladl1 PE=2 SV=1 4 313 6.0E-50
sp|Q9CZR2|NALD2_MOUSE N-acetylated-alpha-linked acidic dipeptidase 2 OS=Mus musculus GN=Naalad2 PE=1 SV=2 1 468 2.0E-49
sp|Q9M1S8|GCP2_ARATH Probable glutamate carboxypeptidase 2 OS=Arabidopsis thaliana GN=AMP1 PE=1 SV=3 12 467 2.0E-48
sp|O54697|NALDL_RAT N-acetylated-alpha-linked acidic dipeptidase-like protein OS=Rattus norvegicus GN=Naaladl1 PE=1 SV=1 8 313 5.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1R0|GCP1_ARTBC Probable glutamate carboxypeptidase ARB_02390 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02390 PE=1 SV=1 12 468 3.0E-51
sp|Q7M758|NALDL_MOUSE N-acetylated-alpha-linked acidic dipeptidase-like protein OS=Mus musculus GN=Naaladl1 PE=2 SV=1 4 313 6.0E-50
sp|Q9CZR2|NALD2_MOUSE N-acetylated-alpha-linked acidic dipeptidase 2 OS=Mus musculus GN=Naalad2 PE=1 SV=2 1 468 2.0E-49
sp|Q9M1S8|GCP2_ARATH Probable glutamate carboxypeptidase 2 OS=Arabidopsis thaliana GN=AMP1 PE=1 SV=3 12 467 2.0E-48
sp|O54697|NALDL_RAT N-acetylated-alpha-linked acidic dipeptidase-like protein OS=Rattus norvegicus GN=Naaladl1 PE=1 SV=1 8 313 5.0E-48
sp|P70627|FOLH1_RAT Glutamate carboxypeptidase 2 OS=Rattus norvegicus GN=Folh1 PE=1 SV=1 3 467 6.0E-48
sp|Q9UQQ1|NALDL_HUMAN N-acetylated-alpha-linked acidic dipeptidase-like protein OS=Homo sapiens GN=NAALADL1 PE=1 SV=2 8 467 1.0E-47
sp|Q04609|FOLH1_HUMAN Glutamate carboxypeptidase 2 OS=Homo sapiens GN=FOLH1 PE=1 SV=1 3 468 1.0E-46
sp|Q9Y3Q0|NALD2_HUMAN N-acetylated-alpha-linked acidic dipeptidase 2 OS=Homo sapiens GN=NAALAD2 PE=1 SV=1 1 318 2.0E-46
sp|O77564|FOLH1_PIG Glutamate carboxypeptidase 2 OS=Sus scrofa GN=FOLH1 PE=1 SV=1 1 467 2.0E-44
sp|O35409|FOLH1_MOUSE Glutamate carboxypeptidase 2 OS=Mus musculus GN=Folh1 PE=1 SV=2 3 467 3.0E-42
sp|O43023|YGV9_SCHPO Inactive zinc metalloprotease C354.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.09c PE=3 SV=1 9 463 2.0E-41
sp|Q9HBA9|FOH1B_HUMAN Putative N-acetylated-alpha-linked acidic dipeptidase OS=Homo sapiens GN=FOLH1B PE=2 SV=1 38 468 2.0E-40
sp|Q5WN23|GCP2_CAEBR Glutamate carboxypeptidase 2 homolog OS=Caenorhabditis briggsae GN=CBG08178 PE=3 SV=1 9 313 1.0E-37
sp|P91406|GCP2_CAEEL Glutamate carboxypeptidase 2 homolog OS=Caenorhabditis elegans GN=R57.1 PE=1 SV=2 9 313 8.0E-36
sp|P47161|VPS70_YEAST Vacuolar protein sorting-associated protein 70 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS70 PE=1 SV=1 12 313 7.0E-33
sp|Q9UP52|TFR2_HUMAN Transferrin receptor protein 2 OS=Homo sapiens GN=TFR2 PE=1 SV=1 8 319 1.0E-27
sp|B2GUY2|TFR2_RAT Transferrin receptor protein 2 OS=Rattus norvegicus GN=Tfr2 PE=2 SV=1 5 319 2.0E-27
sp|Q9JKX3|TFR2_MOUSE Transferrin receptor protein 2 OS=Mus musculus GN=Tfr2 PE=1 SV=2 5 319 2.0E-27
sp|Q2V905|TFR1_HORSE Transferrin receptor protein 1 OS=Equus caballus GN=TFRC PE=2 SV=1 4 357 4.0E-25
sp|Q08919|TRE1_YEAST Uncharacterized protein TRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRE1 PE=1 SV=1 5 464 1.0E-24
sp|Q9GLD3|TFR1_CANLF Transferrin receptor protein 1 OS=Canis lupus familiaris GN=TFRC PE=1 SV=1 4 357 4.0E-24
sp|Q9MYZ3|TFR1_FELCA Transferrin receptor protein 1 OS=Felis catus GN=TFRC PE=1 SV=1 4 266 5.0E-24
sp|Q8HZV3|TFR1_PIG Transferrin receptor protein 1 OS=Sus scrofa GN=TFRC PE=2 SV=1 4 267 2.0E-23
sp|Q08693|TRE2_YEAST Putative zinc metalloprotease TRE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRE2 PE=1 SV=1 12 470 1.0E-21
sp|Q99376|TFR1_RAT Transferrin receptor protein 1 (Fragment) OS=Rattus norvegicus GN=Tfrc PE=2 SV=1 4 357 5.0E-21
sp|Q07891|TFR1_CRIGR Transferrin receptor protein 1 OS=Cricetulus griseus GN=TFRC PE=2 SV=1 4 266 8.0E-21
sp|Q5RDH6|TFR1_PONAB Transferrin receptor protein 1 OS=Pongo abelii GN=TFRC PE=2 SV=1 8 267 3.0E-20
sp|P02786|TFR1_HUMAN Transferrin receptor protein 1 OS=Homo sapiens GN=TFRC PE=1 SV=2 8 266 5.0E-20
sp|Q58DX5|NADL2_HUMAN Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2 OS=Homo sapiens GN=NAALADL2 PE=1 SV=3 77 303 2.0E-19
sp|Q90997|TFR1_CHICK Transferrin receptor protein 1 OS=Gallus gallus GN=TFRC PE=2 SV=2 5 202 3.0E-19
sp|Q62351|TFR1_MOUSE Transferrin receptor protein 1 OS=Mus musculus GN=Tfrc PE=1 SV=1 4 357 9.0E-19
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Extracellular Signal peptide 0.5725 0.1117 0.7828 0.1801 0.3203 0.0669 0.2042 0.5116 0.303 0.2718

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 45.40 24.65 66.15
CcL In ants, during behavior modification 49.41 26.71 72.12
CcD In ants, recently dead 40.12 21.35 58.89

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.761556 no
SC16a CcD 0.637736 no
CcL CcD 0.390597 no

Orthologs

Orthofinder run ID4
Orthogroup4186
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5157
Ophiocordyceps australis map64 (Brazil) OphauB2|8090
Ophiocordyceps camponoti-floridani Ophcf2|04694
Ophiocordyceps camponoti-rufipedis Ophun1|6420
Ophiocordyceps kimflemingae Ophio5|6728 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8503

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6728
MRINETVGLVGIPSLPLAWRDAQELLRRLRGQGVRVPAGWAGGVPDLGDGWWTGNRTRTSPVVRLRNEQDEMDQQ
PIWNVYGKILGQEQAERSILVGNHRDSWAFGAADPHAGTAVMIELARILGGLIARGWRPLRTIEFMSWDGAAYNL
MGSTEFVEKRVQGLREGAYAYINLDAAVSGTRLQAAGSPAMQRPLERAMNHVFDARANQTLGELWRSKGGQLKGL
GAGGDYAALQHMAGTSSLDLAFVDDQDNKGVPVAHSSYDRLALVEEVVDPGFTYHVLLAQLVGVLLLDLADRPVV
PFGMTAYADVLKKEVADLDGWLTVRAEGGEKRAGGDGERQQRDQDKQRRQAMRELIDAAELVGSNAHDFDDWERE
WDRTMLMKGGRESLELSGRRFRFNDKKAAFETALLDLELGGGHVVYGPELWSPRRAAVFPAIRDTVEAGDWAGAR
RAIAKTAAILRRAGSVLTMEDEES
Coding >Ophio5|6728
ATGAGGATCAACGAGACGGTCGGCCTCGTCGGCATCCCGAGTCTACCGCTAGCCTGGCGCGACGCCCAGGAGTTA
CTGCGTCGGCTGCGCGGCCAAGGCGTACGAGTGCCGGCCGGCTGGGCAGGCGGCGTGCCGGACCTGGGCGACGGC
TGGTGGACCGGCAACCGGACCCGGACCTCGCCCGTGGTGCGGCTACGAAACGAGCAGGACGAGATGGATCAGCAG
CCCATCTGGAATGTGTACGGCAAGATTCTGGGCCAGGAGCAGGCGGAGCGGTCCATCCTGGTGGGAAACCATCGC
GACTCTTGGGCGTTTGGCGCCGCCGATCCGCATGCCGGCACGGCCGTCATGATTGAGTTGGCCCGCATCCTCGGA
GGGCTCATCGCCCGCGGCTGGCGGCCTCTGCGGACCATCGAATTCATGTCGTGGGACGGCGCGGCGTACAACCTG
ATGGGCTCGACCGAGTTCGTCGAGAAGCGGGTGCAAGGGCTGCGGGAGGGAGCCTACGCCTACATCAACCTCGAT
GCCGCCGTCTCCGGCACGCGCCTTCAGGCGGCGGGCTCCCCGGCGATGCAGCGGCCACTGGAGCGGGCAATGAAC
CATGTCTTTGATGCGCGGGCCAACCAGACGCTGGGCGAGCTGTGGAGATCCAAGGGCGGGCAGCTCAAGGGCCTC
GGCGCGGGGGGCGACTACGCTGCGCTGCAGCACATGGCCGGCACCAGCTCGCTCGACCTGGCCTTTGTCGACGAC
CAAGACAATAAGGGCGTCCCCGTCGCGCATTCGAGCTACGATAGGCTGGCGCTGGTCGAGGAGGTGGTGGACCCG
GGCTTCACATACCACGTACTCCTGGCGCAGCTGGTGGGCGTGCTGCTGCTCGACCTGGCCGATCGGCCGGTGGTC
CCGTTTGGGATGACGGCTTATGCTGACGTGTTGAAGAAGGAGGTGGCTGATTTGGATGGCTGGCTGACGGTTCGG
GCCGAAGGAGGGGAGAAACGGGCTGGCGGGGATGGAGAGAGGCAACAACGAGATCAAGACAAGCAGCGGCGGCAA
GCGATGCGGGAGCTCATCGACGCCGCCGAGCTGGTTGGCTCCAACGCCCACGACTTTGACGACTGGGAGCGCGAG
TGGGACCGAACGATGCTGATGAAGGGCGGCCGGGAGTCTCTGGAGCTGTCGGGGCGGCGGTTCCGGTTCAATGAC
AAGAAGGCGGCTTTTGAGACGGCCTTGCTGGACTTGGAGCTGGGGGGAGGCCACGTCGTCTACGGGCCCGAGTTG
TGGTCTCCACGCCGCGCGGCCGTGTTCCCCGCCATCCGCGATACGGTCGAGGCCGGAGACTGGGCTGGGGCGAGG
CGTGCGATTGCCAAGACGGCGGCGATACTGCGGAGGGCTGGTTCGGTGCTGACGATGGAGGATGAGGAGAGT
Transcript >Ophio5|6728
ATGAGGATCAACGAGACGGTCGGCCTCGTCGGCATCCCGAGTCTACCGCTAGCCTGGCGCGACGCCCAGGAGTTA
CTGCGTCGGCTGCGCGGCCAAGGCGTACGAGTGCCGGCCGGCTGGGCAGGCGGCGTGCCGGACCTGGGCGACGGC
TGGTGGACCGGCAACCGGACCCGGACCTCGCCCGTGGTGCGGCTACGAAACGAGCAGGACGAGATGGATCAGCAG
CCCATCTGGAATGTGTACGGCAAGATTCTGGGCCAGGAGCAGGCGGAGCGGTCCATCCTGGTGGGAAACCATCGC
GACTCTTGGGCGTTTGGCGCCGCCGATCCGCATGCCGGCACGGCCGTCATGATTGAGTTGGCCCGCATCCTCGGA
GGGCTCATCGCCCGCGGCTGGCGGCCTCTGCGGACCATCGAATTCATGTCGTGGGACGGCGCGGCGTACAACCTG
ATGGGCTCGACCGAGTTCGTCGAGAAGCGGGTGCAAGGGCTGCGGGAGGGAGCCTACGCCTACATCAACCTCGAT
GCCGCCGTCTCCGGCACGCGCCTTCAGGCGGCGGGCTCCCCGGCGATGCAGCGGCCACTGGAGCGGGCAATGAAC
CATGTCTTTGATGCGCGGGCCAACCAGACGCTGGGCGAGCTGTGGAGATCCAAGGGCGGGCAGCTCAAGGGCCTC
GGCGCGGGGGGCGACTACGCTGCGCTGCAGCACATGGCCGGCACCAGCTCGCTCGACCTGGCCTTTGTCGACGAC
CAAGACAATAAGGGCGTCCCCGTCGCGCATTCGAGCTACGATAGGCTGGCGCTGGTCGAGGAGGTGGTGGACCCG
GGCTTCACATACCACGTACTCCTGGCGCAGCTGGTGGGCGTGCTGCTGCTCGACCTGGCCGATCGGCCGGTGGTC
CCGTTTGGGATGACGGCTTATGCTGACGTGTTGAAGAAGGAGGTGGCTGATTTGGATGGCTGGCTGACGGTTCGG
GCCGAAGGAGGGGAGAAACGGGCTGGCGGGGATGGAGAGAGGCAACAACGAGATCAAGACAAGCAGCGGCGGCAA
GCGATGCGGGAGCTCATCGACGCCGCCGAGCTGGTTGGCTCCAACGCCCACGACTTTGACGACTGGGAGCGCGAG
TGGGACCGAACGATGCTGATGAAGGGCGGCCGGGAGTCTCTGGAGCTGTCGGGGCGGCGGTTCCGGTTCAATGAC
AAGAAGGCGGCTTTTGAGACGGCCTTGCTGGACTTGGAGCTGGGGGGAGGCCACGTCGTCTACGGGCCCGAGTTG
TGGTCTCCACGCCGCGCGGCCGTGTTCCCCGCCATCCGCGATACGGTCGAGGCCGGAGACTGGGCTGGGGCGAGG
CGTGCGATTGCCAAGACGGCGGCGATACTGCGGAGGGCTGGTTCGGTGCTGACGATGGAGGATGAGGAGAGTTGA
Gene >Ophio5|6728
ATGAGGATCAACGAGACGGTCGGCCTCGTCGGCATCCCGAGTCTACCGCTAGCCTGGCGCGACGCCCAGGAGTTA
CTGCGTCGGCTGCGCGGCCAAGGCGTACGAGTGCCGGCCGGCTGGGCAGGCGGCGTGCCGGACCTGGGCGACGGC
TGGTGGACCGGCAACCGGACCCGGACCTCGCCCGTGGTGCGGCTACGAAACGAGCAGGACGAGATGGATCAGCAG
CCCATCTGGAATGTGTACGGCAAGATTCTGGGCCAGGAGCAGGCGGAGCGGTCCATCCTGGTGGGAAACCATCGC
GACTCTTGGGCGTTTGGCGCCGCCGATCCGCATGCCGGCACGGCCGTCATGATTGAGTTGGCCCGCATCCTCGGA
GGGCTCATCGCCCGCGGCTGGCGGCCTCTGCGGACCATCGAATTCATGTCGTGGGACGGCGCGGCGTACAACCTG
ATGGGCTCGACCGAGTTCGTCGAGAAGCGGGTGCAAGGGCTGCGGGAGGGAGCCTACGCCTACATCAACCTCGAT
GCCGCCGTCTCCGGCACGCGCCTTCAGGCGGCGGGCTCCCCGGCGATGCAGCGGCCACTGGAGCGGGCAATGAAC
CATGTCTTTGATGCGCGGGCCAACCAGACGCTGGGCGAGCTGTGGAGATCCAAGGGCGGGCAGCTCAAGGGCCTC
GGCGCGGGGGGCGACTACGCTGCGCTGCAGCACATGGCCGGCACCAGCTCGCTCGACCTGGCCTTTGTCGACGAC
CAAGACAATAAGGGCGTCCCCGTCGCGCATTCGAGCTACGATAGGCTGGCGCTGGTCGAGGAGGTGGTGGACCCG
GGCTTCACATACCACGTACTCCTGGCGCAGCTGGTGGGCGTGCTGCTGCTCGACCTGGCCGATCGGCCGGTGGTC
CCGTTTGGGATGACGGCTTATGCTGACGTGTTGAAGAAGGAGGTGGCTGATTTGGATGGCTGGCTGACGGTTCGG
GCCGAAGGAGGGGAGAAACGGGCTGGCGGGGATGGAGAGAGGCAACAACGAGATCAAGACAAGCAGCGGCGGCAA
GCGATGCGGGAGCTCATCGACGCCGCCGAGCTGGTTGGCTCCAACGCCCACGACTTTGACGACTGGGAGCGCGAG
TGGGACCGAACGATGCTGATGAAGGGCGGCCGGGAGTCTCTGGAGCTGTCGGGGCGGCGGTTCCGGTTCAATGAC
AAGAAGGCGGCTTTTGAGACGGCCTTGCTGGACTTGGAGCTGGGGGGAGGCGTGAGTTTTTTGTTTTGTTTTTTT
GGTCCTTTTTATTTCTCTCCCTACTTGGTCACTCTGTTTTCCGTGAAAGACAACACTGACGTCGGGGGCCCCTTT
TCAGATCCCCAACCGCACGCAATACAAGCACGTCGTCTACGGGCCCGAGTTGTGGTCTCCACGCCGCGCGGCCGT
GTTCCCCGCCATCCGCGATACGGTCGAGGCCGGAGACTGGGCTGGGGCGAGGCGTGCGATTGCCAAGACGGCGGC
GATACTGCGGAGGGCTGGTTCGGTGCTGACGATGGAGGATGAGGAGAGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail