Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6726
Gene name
Locationscaffold_60:41013..42665
Strand+
Gene length (bp)1652
Transcript length (bp)1596
Coding sequence length (bp)1593
Protein length (aa) 531

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04280 Tim44 Tim44-like domain 5.6E-35 372 525

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60084|TIM44_SCHPO Mitochondrial import inner membrane translocase subunit tim44 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tim44 PE=3 SV=1 151 526 3.0E-98
sp|Q01852|TIM44_YEAST Mitochondrial import inner membrane translocase subunit TIM44 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM44 PE=1 SV=1 151 527 3.0E-89
sp|O35857|TIM44_MOUSE Mitochondrial import inner membrane translocase subunit TIM44 OS=Mus musculus GN=Timm44 PE=1 SV=2 157 526 8.0E-43
sp|O43615|TIM44_HUMAN Mitochondrial import inner membrane translocase subunit TIM44 OS=Homo sapiens GN=TIMM44 PE=1 SV=2 157 526 9.0E-42
sp|O35094|TIM44_RAT Mitochondrial import inner membrane translocase subunit TIM44 OS=Rattus norvegicus GN=Timm44 PE=1 SV=1 157 526 6.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60084|TIM44_SCHPO Mitochondrial import inner membrane translocase subunit tim44 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tim44 PE=3 SV=1 151 526 3.0E-98
sp|Q01852|TIM44_YEAST Mitochondrial import inner membrane translocase subunit TIM44 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM44 PE=1 SV=1 151 527 3.0E-89
sp|O35857|TIM44_MOUSE Mitochondrial import inner membrane translocase subunit TIM44 OS=Mus musculus GN=Timm44 PE=1 SV=2 157 526 8.0E-43
sp|O43615|TIM44_HUMAN Mitochondrial import inner membrane translocase subunit TIM44 OS=Homo sapiens GN=TIMM44 PE=1 SV=2 157 526 9.0E-42
sp|O35094|TIM44_RAT Mitochondrial import inner membrane translocase subunit TIM44 OS=Rattus norvegicus GN=Timm44 PE=1 SV=1 157 526 6.0E-41
sp|O02161|TIM44_CAEEL Probable mitochondrial import inner membrane translocase subunit tin-44 OS=Caenorhabditis elegans GN=tin-44 PE=3 SV=1 157 524 2.0E-34
sp|Q5XF06|TI442_ARATH Mitochondrial import inner membrane translocase subunit TIM44-2 OS=Arabidopsis thaliana GN=TIM44-2 PE=1 SV=1 316 527 3.0E-16
sp|Q1PF33|TI441_ARATH Mitochondrial import inner membrane translocase subunit TIM44-1 OS=Arabidopsis thaliana GN=TIM44-1 PE=2 SV=1 344 527 3.0E-14
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6726
MPSLVRSAPSTACALSRAAARPVYAYGRSPAYRRLASHLPRHRASTLLPPLLSSDALRSPLSWRQFHLSVPRCQD
EAKPGSTEAPKAKTNEASKAKSDEPAPAPEGEESAKKGPEDGENENQQKTEGDETKEGDGKAEKEDLPPPPPHGD
KTPWQVFMETMNSEFQRSKEWNESTKQIGAAAHQFTESESVRKAREAYERSTGAVSSTASRAMKSTAGAIGKGAA
WTWDTPVMKGVRKAANVTGEAVEKATKPIRDTEAYKNVKDVIDDGSSSRYGGWVEKEERRKKRALKQAERAEGVP
VPEEDANAGTNLTVHKDAAWKEAWRDFRDSNRLMQGLFSMKGKYEESENPLISTARSITDRIGGFFAENETAMVI
KKFRAMDPAFQVEPFLQDLREYMLPEVLDAYVKGDTETLRLWLSAAQYSVYEALTKQYLQAGMKSDGRILDIRNV
DILRARMLDPGEVPVFIITCRTQEVHVYRHAKTNELAAGMEDKVQLVTYAIGITRVAEDVNNPETRGWRMIEMQK
SGRDWY
Coding >Ophio5|6726
ATGCCATCCTTGGTCCGAAGCGCGCCCAGCACAGCATGTGCGCTTTCGAGGGCAGCAGCCCGTCCCGTTTACGCT
TATGGAAGGTCTCCCGCCTATCGTAGGTTAGCCTCACACCTCCCACGTCACCGAGCGTCAACTCTTCTCCCGCCG
CTGCTATCGTCAGACGCCTTGCGATCGCCTCTCTCATGGCGACAATTCCACCTCTCCGTTCCAAGATGCCAAGAC
GAGGCAAAGCCCGGATCGACCGAGGCGCCCAAGGCCAAGACCAACGAGGCGTCCAAGGCCAAGTCAGACGAGCCG
GCTCCCGCGCCCGAGGGAGAGGAATCTGCGAAAAAGGGCCCCGAAGATGGCGAAAATGAAAACCAGCAGAAGACC
GAGGGAGACGAGACCAAGGAAGGAGACGGGAAGGCCGAAAAAGAGGATCTGCCCCCTCCGCCGCCGCACGGCGAT
AAAACGCCGTGGCAGGTGTTCATGGAAACGATGAACAGCGAGTTCCAGAGGTCCAAGGAGTGGAACGAGTCCACC
AAGCAGATCGGCGCCGCGGCCCATCAGTTCACGGAGAGCGAGTCTGTGCGCAAGGCGCGCGAAGCCTACGAGCGC
TCCACGGGCGCCGTGTCCTCGACGGCCTCCCGGGCCATGAAGTCGACGGCGGGTGCCATCGGAAAGGGTGCCGCC
TGGACCTGGGACACTCCCGTCATGAAGGGTGTGCGCAAGGCGGCCAACGTGACGGGCGAGGCTGTCGAGAAGGCC
ACCAAACCGATCCGTGACACCGAAGCGTACAAGAACGTCAAGGACGTCATCGACGACGGAAGCTCCTCGAGATAC
GGTGGCTGGGTCGAGAAGGAGGAGCGGAGGAAGAAGAGGGCTCTGAAGCAGGCTGAGCGCGCCGAGGGCGTCCCT
GTGCCGGAAGAGGATGCCAACGCTGGGACCAACTTGACCGTACACAAGGACGCGGCTTGGAAGGAGGCGTGGCGA
GACTTCCGCGACTCCAACCGGCTGATGCAGGGCCTGTTTAGCATGAAGGGCAAATACGAGGAGTCGGAGAACCCG
CTGATCTCGACGGCGCGCAGCATCACGGACCGCATCGGCGGCTTCTTTGCCGAAAACGAGACGGCCATGGTGATC
AAGAAGTTCCGCGCCATGGACCCGGCCTTCCAGGTGGAGCCGTTCTTGCAAGACCTCCGCGAGTACATGCTCCCC
GAGGTGCTGGACGCGTACGTCAAGGGCGACACGGAGACGCTCCGGCTATGGCTCTCTGCGGCGCAGTACTCGGTG
TACGAGGCGCTGACGAAGCAGTACCTACAAGCGGGCATGAAGTCGGACGGACGGATCCTGGACATACGGAACGTG
GACATATTGCGGGCGCGGATGCTGGACCCGGGCGAGGTGCCCGTCTTCATCATCACGTGCCGCACGCAGGAGGTG
CACGTCTACCGCCACGCCAAGACGAACGAGCTGGCGGCGGGCATGGAGGACAAGGTGCAGCTGGTGACGTACGCC
ATTGGCATCACGCGCGTGGCCGAGGACGTCAACAACCCGGAGACGCGAGGATGGCGGATGATTGAGATGCAGAAG
AGCGGGAGGGACTGGTAT
Transcript >Ophio5|6726
ATGCCATCCTTGGTCCGAAGCGCGCCCAGCACAGCATGTGCGCTTTCGAGGGCAGCAGCCCGTCCCGTTTACGCT
TATGGAAGGTCTCCCGCCTATCGTAGGTTAGCCTCACACCTCCCACGTCACCGAGCGTCAACTCTTCTCCCGCCG
CTGCTATCGTCAGACGCCTTGCGATCGCCTCTCTCATGGCGACAATTCCACCTCTCCGTTCCAAGATGCCAAGAC
GAGGCAAAGCCCGGATCGACCGAGGCGCCCAAGGCCAAGACCAACGAGGCGTCCAAGGCCAAGTCAGACGAGCCG
GCTCCCGCGCCCGAGGGAGAGGAATCTGCGAAAAAGGGCCCCGAAGATGGCGAAAATGAAAACCAGCAGAAGACC
GAGGGAGACGAGACCAAGGAAGGAGACGGGAAGGCCGAAAAAGAGGATCTGCCCCCTCCGCCGCCGCACGGCGAT
AAAACGCCGTGGCAGGTGTTCATGGAAACGATGAACAGCGAGTTCCAGAGGTCCAAGGAGTGGAACGAGTCCACC
AAGCAGATCGGCGCCGCGGCCCATCAGTTCACGGAGAGCGAGTCTGTGCGCAAGGCGCGCGAAGCCTACGAGCGC
TCCACGGGCGCCGTGTCCTCGACGGCCTCCCGGGCCATGAAGTCGACGGCGGGTGCCATCGGAAAGGGTGCCGCC
TGGACCTGGGACACTCCCGTCATGAAGGGTGTGCGCAAGGCGGCCAACGTGACGGGCGAGGCTGTCGAGAAGGCC
ACCAAACCGATCCGTGACACCGAAGCGTACAAGAACGTCAAGGACGTCATCGACGACGGAAGCTCCTCGAGATAC
GGTGGCTGGGTCGAGAAGGAGGAGCGGAGGAAGAAGAGGGCTCTGAAGCAGGCTGAGCGCGCCGAGGGCGTCCCT
GTGCCGGAAGAGGATGCCAACGCTGGGACCAACTTGACCGTACACAAGGACGCGGCTTGGAAGGAGGCGTGGCGA
GACTTCCGCGACTCCAACCGGCTGATGCAGGGCCTGTTTAGCATGAAGGGCAAATACGAGGAGTCGGAGAACCCG
CTGATCTCGACGGCGCGCAGCATCACGGACCGCATCGGCGGCTTCTTTGCCGAAAACGAGACGGCCATGGTGATC
AAGAAGTTCCGCGCCATGGACCCGGCCTTCCAGGTGGAGCCGTTCTTGCAAGACCTCCGCGAGTACATGCTCCCC
GAGGTGCTGGACGCGTACGTCAAGGGCGACACGGAGACGCTCCGGCTATGGCTCTCTGCGGCGCAGTACTCGGTG
TACGAGGCGCTGACGAAGCAGTACCTACAAGCGGGCATGAAGTCGGACGGACGGATCCTGGACATACGGAACGTG
GACATATTGCGGGCGCGGATGCTGGACCCGGGCGAGGTGCCCGTCTTCATCATCACGTGCCGCACGCAGGAGGTG
CACGTCTACCGCCACGCCAAGACGAACGAGCTGGCGGCGGGCATGGAGGACAAGGTGCAGCTGGTGACGTACGCC
ATTGGCATCACGCGCGTGGCCGAGGACGTCAACAACCCGGAGACGCGAGGATGGCGGATGATTGAGATGCAGAAG
AGCGGGAGGGACTGGTATTGA
Gene >Ophio5|6726
ATGCCATCCTTGGTCCGAAGCGCGCCCAGCACAGCATGTGCGCTTTCGAGGGCAGCAGCCCGTCCCGTTTACGCT
TATGGAAGGTCTCCCGCCTATCGTAGGTTAGCCTCACACCTCCCACGTCACCGAGCGTCAACTCTTCTCCCGCCG
CTGCTATCGTCAGACGCCTTGCGATCGCCTCTCTCATGGCGACAATTCCACCTCTCCGTTCCAAGATGCCAAGAC
GAGGCAAAGCCCGGATCGACCGAGGCGCCCAAGGCCAAGACCAACGAGGCGTCCAAGGCCAAGTCAGACGAGCCG
GCTCCCGCGCCCGAGGGAGAGGAATCTGCGAAAAAGGGCCCCGAAGATGGCGAAAATGAAAACCAGCAGAAGACC
GAGGGAGACGAGACCAAGGAAGGAGACGGGAAGGCCGAAAAAGAGGATCTGCCCCCTCCGCCGCCGCACGGCGAT
AAAACGCCGTGGCAGGTGTTCATGGAAACGATGAACAGCGAGTTCCAGAGGTCCAAGGAGTGGAACGAGTCCACC
AAGCAGATCGGCGCCGCGGCCCATCAGTTCACGGAGAGCGAGTCTGTGCGCAAGGCGCGCGAAGCCTACGAGCGC
TCCACGGGCGCCGTGTCCTCGACGGCCTCCCGGGCCATGAAGTCGACGGCGGGTGCCATCGGAAAGGGTGCCGCC
TGGACCTGGGACACTCCCGTCATGAAGGGTGTGCGCAAGGCGGCCAACGTGACGGGCGAGGCTGTCGAGAAGGCC
ACCAAACCGATCCGTGACACCGAAGCGTACAAGAACGTCAAGGACGTCATCGACGACGGAAGCTCCTCGAGATAC
GGTGGCTGGGTCGAGAAGGAGGAGCGGAGGAAGAAGAGGGCTCTGAAGCAGGCTGAGCGCGCCGAGGGCGTCCCT
GTGCCGGAAGAGGATGCCAAGTCAGTCAGCGATTCCCGTTGGCCGAGTAAGACGCGCCGCTGACGAAGAATAACA
GCGCTGGGACCAACTTGACCGTACACAAGGACGCGGCTTGGAAGGAGGCGTGGCGAGACTTCCGCGACTCCAACC
GGCTGATGCAGGGCCTGTTTAGCATGAAGGGCAAATACGAGGAGTCGGAGAACCCGCTGATCTCGACGGCGCGCA
GCATCACGGACCGCATCGGCGGCTTCTTTGCCGAAAACGAGACGGCCATGGTGATCAAGAAGTTCCGCGCCATGG
ACCCGGCCTTCCAGGTGGAGCCGTTCTTGCAAGACCTCCGCGAGTACATGCTCCCCGAGGTGCTGGACGCGTACG
TCAAGGGCGACACGGAGACGCTCCGGCTATGGCTCTCTGCGGCGCAGTACTCGGTGTACGAGGCGCTGACGAAGC
AGTACCTACAAGCGGGCATGAAGTCGGACGGACGGATCCTGGACATACGGAACGTGGACATATTGCGGGCGCGGA
TGCTGGACCCGGGCGAGGTGCCCGTCTTCATCATCACGTGCCGCACGCAGGAGGTGCACGTCTACCGCCACGCCA
AGACGAACGAGCTGGCGGCGGGCATGGAGGACAAGGTGCAGCTGGTGACGTACGCCATTGGCATCACGCGCGTGG
CCGAGGACGTCAACAACCCGGAGACGCGAGGATGGCGGATGATTGAGATGCAGAAGAGCGGGAGGGACTGGTATT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail