Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6715
Gene name
Locationscaffold_60:7001..8822
Strand+
Gene length (bp)1821
Transcript length (bp)1668
Coding sequence length (bp)1665
Protein length (aa) 555

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00856 SET SET domain 3.5E-08 19 248
PF01753 zf-MYND MYND finger 1.1E-05 54 94

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NRG4|SMYD2_HUMAN N-lysine methyltransferase SMYD2 OS=Homo sapiens GN=SMYD2 PE=1 SV=2 15 289 3.0E-21
sp|E1C5V0|SMYD2_CHICK N-lysine methyltransferase SMYD2 OS=Gallus gallus GN=SMYD2 PE=3 SV=1 14 294 3.0E-20
sp|Q7XJS0|ASHR1_ARATH Histone-lysine N-methyltransferase ASHR1 OS=Arabidopsis thaliana GN=ASHR1 PE=2 SV=2 16 274 1.0E-19
sp|C3RZA1|SMYD2_PIG N-lysine methyltransferase SMYD2 OS=Sus scrofa GN=SMYD2 PE=2 SV=1 15 274 2.0E-19
sp|Q5RGL7|SMY2B_DANRE N-lysine methyltransferase SMYD2-B OS=Danio rerio GN=smyd2b PE=2 SV=2 1 292 2.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NRG4|SMYD2_HUMAN N-lysine methyltransferase SMYD2 OS=Homo sapiens GN=SMYD2 PE=1 SV=2 15 289 3.0E-21
sp|E1C5V0|SMYD2_CHICK N-lysine methyltransferase SMYD2 OS=Gallus gallus GN=SMYD2 PE=3 SV=1 14 294 3.0E-20
sp|Q7XJS0|ASHR1_ARATH Histone-lysine N-methyltransferase ASHR1 OS=Arabidopsis thaliana GN=ASHR1 PE=2 SV=2 16 274 1.0E-19
sp|C3RZA1|SMYD2_PIG N-lysine methyltransferase SMYD2 OS=Sus scrofa GN=SMYD2 PE=2 SV=1 15 274 2.0E-19
sp|Q5RGL7|SMY2B_DANRE N-lysine methyltransferase SMYD2-B OS=Danio rerio GN=smyd2b PE=2 SV=2 1 292 2.0E-19
sp|Q0P585|SMYD2_BOVIN N-lysine methyltransferase SMYD2 OS=Bos taurus GN=SMYD2 PE=2 SV=1 15 274 2.0E-19
sp|Q9H7B4|SMYD3_HUMAN Histone-lysine N-methyltransferase SMYD3 OS=Homo sapiens GN=SMYD3 PE=1 SV=4 14 275 5.0E-19
sp|Q8R5A0|SMYD2_MOUSE N-lysine methyltransferase SMYD2 OS=Mus musculus GN=Smyd2 PE=1 SV=1 15 289 7.0E-19
sp|Q9CWR2|SMYD3_MOUSE Histone-lysine N-methyltransferase SMYD3 OS=Mus musculus GN=Smyd3 PE=2 SV=1 17 275 3.0E-18
sp|Q7M6Z3|SMYD2_RAT N-lysine methyltransferase SMYD2 OS=Rattus norvegicus GN=Smyd2 PE=1 SV=1 15 289 7.0E-18
sp|Q7ZXV5|SMY2A_XENLA N-lysine methyltransferase SMYD2-A OS=Xenopus laevis GN=smyd2-a PE=2 SV=1 15 289 7.0E-18
sp|O94256|SET6_SCHPO SET domain and MYND-type zinc finger protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set6 PE=3 SV=1 1 277 3.0E-17
sp|Q5BJI7|SMY2A_DANRE N-lysine methyltransferase SMYD2-A OS=Danio rerio GN=smyd2a PE=2 SV=1 15 274 8.0E-17
sp|Q54D67|Y2454_DICDI SET and MYND domain-containing protein DDB_G0292454 OS=Dictyostelium discoideum GN=DDB_G0292454 PE=3 SV=1 18 278 2.0E-16
sp|Q6GN68|SMY2B_XENLA N-lysine methyltransferase SMYD2-B OS=Xenopus laevis GN=smyd2-b PE=2 SV=1 15 274 8.0E-16
sp|Q9ZUM9|ASHR2_ARATH Histone-lysine N-methyltransferase ASHR2 OS=Arabidopsis thaliana GN=ASHR2 PE=2 SV=3 18 279 8.0E-09
sp|Q557F7|Y3589_DICDI SET and MYND domain-containing protein DDB_G0273589 OS=Dictyostelium discoideum GN=DDB_G0273589 PE=3 SV=1 14 279 9.0E-09
sp|Q5PP37|ATXR2_ARATH Histone-lysine N-methyltransferase ATXR2 OS=Arabidopsis thaliana GN=ATXR2 PE=2 SV=1 197 277 8.0E-07
sp|Q6BSV3|SET5_DEBHA Potential protein lysine methyltransferase SET5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SET5 PE=3 SV=2 195 295 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6715
MDAPSQPALQIGDASPDRGRGLFAAQAFRPGQTIQVFDRPLLALTATPLLERVCSHCLRVGEKKPRGCSRCCAAF
YCDAVCQSAAWAAVHGRECKALGRKRLRLDGAGGGLPARLPTPVRALVQALVCPDVETALGSLQGHRPCDGALTD
LLVMARAGCAFAGVEAGEKGTGAGAGLMRAVELLCKIQTNAFHRYDADLGQAGIFLEPTLAMANHSCIPNALVHF
VGRTAILTAERPIEPGDEVEISYTDYTYPLAKRGEALSSYGFDCRCQRCKEDLNVYQVRFTSSPDAILDNACLVS
PDDFFKLRSHPAIVDPATQSLARTDSETAVKSFESRPSSDEAPSTRRQMLLAQLRDCAGLATAGLWAVTPVPQIL
TELSINYAERGDFASALALACFIATSCDPYRYTACFHPTRIKNVLVVAKMLANTAEETAALSQAVERVTSRPKLE
RKLRETLRDIDQASLCQMLLIMVLQSVPAGRGGAEWELAMAARDMLRDIEQLPGRDQEVSLITAWTRDPTTDQSR
AFFDYAVVQRVDILAGLGRELLLVDLDTET
Coding >Ophio5|6715
ATGGACGCTCCCTCGCAGCCGGCGCTTCAGATCGGCGACGCCAGCCCCGACCGTGGCCGCGGCCTATTCGCCGCC
CAAGCCTTCCGGCCAGGCCAGACGATACAGGTCTTCGACCGGCCGCTACTGGCGCTGACGGCGACGCCGCTCCTG
GAACGCGTCTGTAGTCACTGCCTGCGGGTCGGGGAGAAGAAGCCGCGCGGCTGCTCGCGCTGCTGTGCCGCCTTC
TACTGCGACGCCGTGTGCCAGAGTGCTGCCTGGGCTGCGGTCCACGGGAGAGAATGTAAGGCGCTCGGCCGGAAA
AGGCTTCGCCTCGATGGTGCTGGCGGCGGCCTGCCTGCGCGGCTGCCGACTCCTGTGCGCGCCCTCGTTCAGGCC
CTCGTGTGCCCGGATGTCGAGACGGCGCTGGGCTCGCTTCAGGGTCATCGTCCCTGTGACGGTGCCTTGACGGAT
CTGCTCGTCATGGCCAGGGCGGGCTGTGCCTTTGCCGGCGTCGAGGCGGGTGAAAAAGGGACTGGTGCTGGTGCT
GGACTGATGAGGGCCGTGGAGCTGCTTTGCAAGATTCAGACCAACGCCTTTCACAGATATGATGCAGACCTGGGC
CAGGCCGGTATCTTCCTCGAACCGACGCTCGCCATGGCCAACCACTCGTGCATCCCAAACGCCCTGGTTCATTTC
GTCGGTCGAACGGCCATCTTGACGGCAGAGCGGCCCATCGAGCCCGGTGACGAAGTCGAAATCTCTTACACTGAC
TACACATACCCTCTCGCCAAGAGGGGCGAGGCGCTCTCGTCCTATGGCTTCGACTGTCGCTGTCAACGCTGCAAA
GAAGACCTCAACGTCTACCAGGTCCGCTTCACCTCCTCTCCAGACGCCATTCTCGACAACGCTTGCCTTGTGTCT
CCGGACGACTTTTTCAAACTCCGCAGCCATCCTGCCATTGTCGACCCGGCGACGCAGTCTCTGGCGAGGACTGAC
AGTGAGACGGCTGTCAAATCCTTCGAATCCCGGCCTTCATCTGACGAGGCTCCCTCGACGCGCCGCCAGATGCTG
CTTGCGCAGTTGCGAGACTGCGCCGGTCTGGCCACCGCCGGACTCTGGGCCGTGACTCCCGTGCCTCAGATACTA
ACGGAATTGTCCATCAACTATGCCGAGCGCGGCGACTTCGCCTCGGCGCTAGCTCTCGCCTGCTTCATCGCGACA
AGTTGCGATCCCTATCGGTACACGGCGTGCTTCCATCCCACCAGAATCAAGAACGTCCTCGTTGTTGCCAAGATG
CTCGCCAACACGGCCGAGGAGACGGCCGCCCTGAGCCAGGCCGTCGAGCGCGTCACGTCCCGGCCCAAGCTCGAG
AGGAAGCTCCGAGAGACGCTTCGCGACATCGACCAGGCCTCGCTGTGTCAGATGCTGCTCATCATGGTGTTGCAG
TCGGTCCCGGCCGGTCGCGGCGGCGCAGAGTGGGAGCTCGCCATGGCGGCCCGGGACATGCTACGGGACATTGAG
CAGCTGCCAGGTCGAGACCAGGAAGTCTCCCTCATCACAGCCTGGACGCGGGATCCGACGACCGACCAGTCTCGG
GCCTTTTTCGACTACGCCGTGGTGCAGCGGGTGGATATCTTGGCCGGTCTCGGGCGCGAATTGCTTCTCGTTGAC
TTGGATACCGAAACC
Transcript >Ophio5|6715
ATGGACGCTCCCTCGCAGCCGGCGCTTCAGATCGGCGACGCCAGCCCCGACCGTGGCCGCGGCCTATTCGCCGCC
CAAGCCTTCCGGCCAGGCCAGACGATACAGGTCTTCGACCGGCCGCTACTGGCGCTGACGGCGACGCCGCTCCTG
GAACGCGTCTGTAGTCACTGCCTGCGGGTCGGGGAGAAGAAGCCGCGCGGCTGCTCGCGCTGCTGTGCCGCCTTC
TACTGCGACGCCGTGTGCCAGAGTGCTGCCTGGGCTGCGGTCCACGGGAGAGAATGTAAGGCGCTCGGCCGGAAA
AGGCTTCGCCTCGATGGTGCTGGCGGCGGCCTGCCTGCGCGGCTGCCGACTCCTGTGCGCGCCCTCGTTCAGGCC
CTCGTGTGCCCGGATGTCGAGACGGCGCTGGGCTCGCTTCAGGGTCATCGTCCCTGTGACGGTGCCTTGACGGAT
CTGCTCGTCATGGCCAGGGCGGGCTGTGCCTTTGCCGGCGTCGAGGCGGGTGAAAAAGGGACTGGTGCTGGTGCT
GGACTGATGAGGGCCGTGGAGCTGCTTTGCAAGATTCAGACCAACGCCTTTCACAGATATGATGCAGACCTGGGC
CAGGCCGGTATCTTCCTCGAACCGACGCTCGCCATGGCCAACCACTCGTGCATCCCAAACGCCCTGGTTCATTTC
GTCGGTCGAACGGCCATCTTGACGGCAGAGCGGCCCATCGAGCCCGGTGACGAAGTCGAAATCTCTTACACTGAC
TACACATACCCTCTCGCCAAGAGGGGCGAGGCGCTCTCGTCCTATGGCTTCGACTGTCGCTGTCAACGCTGCAAA
GAAGACCTCAACGTCTACCAGGTCCGCTTCACCTCCTCTCCAGACGCCATTCTCGACAACGCTTGCCTTGTGTCT
CCGGACGACTTTTTCAAACTCCGCAGCCATCCTGCCATTGTCGACCCGGCGACGCAGTCTCTGGCGAGGACTGAC
AGTGAGACGGCTGTCAAATCCTTCGAATCCCGGCCTTCATCTGACGAGGCTCCCTCGACGCGCCGCCAGATGCTG
CTTGCGCAGTTGCGAGACTGCGCCGGTCTGGCCACCGCCGGACTCTGGGCCGTGACTCCCGTGCCTCAGATACTA
ACGGAATTGTCCATCAACTATGCCGAGCGCGGCGACTTCGCCTCGGCGCTAGCTCTCGCCTGCTTCATCGCGACA
AGTTGCGATCCCTATCGGTACACGGCGTGCTTCCATCCCACCAGAATCAAGAACGTCCTCGTTGTTGCCAAGATG
CTCGCCAACACGGCCGAGGAGACGGCCGCCCTGAGCCAGGCCGTCGAGCGCGTCACGTCCCGGCCCAAGCTCGAG
AGGAAGCTCCGAGAGACGCTTCGCGACATCGACCAGGCCTCGCTGTGTCAGATGCTGCTCATCATGGTGTTGCAG
TCGGTCCCGGCCGGTCGCGGCGGCGCAGAGTGGGAGCTCGCCATGGCGGCCCGGGACATGCTACGGGACATTGAG
CAGCTGCCAGGTCGAGACCAGGAAGTCTCCCTCATCACAGCCTGGACGCGGGATCCGACGACCGACCAGTCTCGG
GCCTTTTTCGACTACGCCGTGGTGCAGCGGGTGGATATCTTGGCCGGTCTCGGGCGCGAATTGCTTCTCGTTGAC
TTGGATACCGAAACCTGA
Gene >Ophio5|6715
ATGGACGCTCCCTCGCAGCCGGCGCTTCAGATCGGCGACGCCAGCCCCGACCGTGGCCGCGGCCTATTCGCCGCC
CAAGCCTTCCGGCCAGGCCAGACGATACAGGTCTTCGACCGGCCGCTACTGGCGCTGACGGCGACGCCGCTCCTG
GAACGCGTCTGTAGTCACTGCCTGCGGGTCGGGGAGAAGAAGCCGCGCGGCTGCTCGCGCTGCTGTGCCGCCTTC
TACTGCGACGCCGTGTGCCAGAGTGCTGCCTGGGCTGCGGTCCACGGGAGAGAATGTAAGGCGCTCGGCCGGAAA
AGGCTTCGCCTCGATGGTGCTGGCGGCGGCCTGCCTGCGCGGCTGCCGACTCCTGTGCGCGCCCTCGTTCAGGCC
CTCGTGTGCCCGGATGTCGAGACGGCGCTGGGCTCGCTTCAGGGTCATCGTCCCTGTGACGGTGCCTTGACGGAT
CTGCTCGTCATGGCCAGGGCGGGCTGTGCCTTTGCCGGCGTCGAGGCGGGTGAAAAAGGGACTGGTGCTGGTGCT
GGACTGATGAGGGCCGTGGAGCTGCTTTGCAAGGTTCGCCTACTCACCATCTCTAACCGTCCTAGTCGGCAGGGC
GCACGAGATTCTATAGCTCACACGTCGAGACATCCGCAGATTCAGACCAACGCCTTTCACAGATATGATGCAGAC
CTGGGCCAGGCCGGTATCTTCCTCGAACCGACGCTCGCCATGGCCAACCACTCGTGCATCCCAAACGCCCTGGTT
CATTTCGTCGGTCGAACGGCCATCTTGACGGCAGAGCGGCCCATCGAGCCCGGTGACGAAGTCGAAATCTCTTAC
ACTGGTCAGTCTACGTAGCGCACCGGCTTCGCTCTCCGCCAACGAGAATAATCTGGTAATCCGACATGTCATCCA
GACTACACATACCCTCTCGCCAAGAGGGGCGAGGCGCTCTCGTCCTATGGCTTCGACTGTCGCTGTCAACGCTGC
AAAGAAGACCTCAACGTCTACCAGGTCCGCTTCACCTCCTCTCCAGACGCCATTCTCGACAACGCTTGCCTTGTG
TCTCCGGACGACTTTTTCAAACTCCGCAGCCATCCTGCCATTGTCGACCCGGCGACGCAGTCTCTGGCGAGGACT
GACAGTGAGACGGCTGTCAAATCCTTCGAATCCCGGCCTTCATCTGACGAGGCTCCCTCGACGCGCCGCCAGATG
CTGCTTGCGCAGTTGCGAGACTGCGCCGGTCTGGCCACCGCCGGACTCTGGGCCGTGACTCCCGTGCCTCAGATA
CTAACGGAATTGTCCATCAACTATGCCGAGCGCGGCGACTTCGCCTCGGCGCTAGCTCTCGCCTGCTTCATCGCG
ACAAGTTGCGATCCCTATCGGTACACGGCGTGCTTCCATCCCACCAGAATCAAGAACGTCCTCGTTGTTGCCAAG
ATGCTCGCCAACACGGCCGAGGAGACGGCCGCCCTGAGCCAGGCCGTCGAGCGCGTCACGTCCCGGCCCAAGCTC
GAGAGGAAGCTCCGAGAGACGCTTCGCGACATCGACCAGGCCTCGCTGTGTCAGATGCTGCTCATCATGGTGTTG
CAGTCGGTCCCGGCCGGTCGCGGCGGCGCAGAGTGGGAGCTCGCCATGGCGGCCCGGGACATGCTACGGGACATT
GAGCAGCTGCCAGGTCGAGACCAGGAAGTCTCCCTCATCACAGCCTGGACGCGGGATCCGACGACCGACCAGTCT
CGGGCCTTTTTCGACTACGCCGTGGTGCAGCGGGTGGATATCTTGGCCGGTCTCGGGCGCGAATTGCTTCTCGTT
GACTTGGATACCGAAACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail