Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6712
Gene name
Locationscaffold_60:282..1012
Strand+
Gene length (bp)730
Transcript length (bp)462
Coding sequence length (bp)459
Protein length (aa) 153

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4367 0.7576 0.3589 0.0583 0.2365 0.0087 0.0351 0.0925 0.0737 0.0297

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4621
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2004
Ophiocordyceps australis map64 (Brazil) OphauB2|5453
Ophiocordyceps camponoti-floridani Ophcf2|04643
Ophiocordyceps camponoti-rufipedis Ophun1|6132
Ophiocordyceps kimflemingae Ophio5|6712 (this protein)
Ophiocordyceps subramaniannii Hirsu2|97

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6712
MSVLLAWLKDLVLLRDRLEVQAGPAGGRPSRDFPPDTWESWIFLESARRTIITASAFMSIFHLLKAEQPVPGVWI
ERQSFTASKHLWEAGSSVDFYRAWREKPHYWVENSGFRDLWMYARPADLDEFTRLMLTPYVGVDAMEHFMEGDFV
MPL
Coding >Ophio5|6712
ATGTCCGTCTTGCTCGCTTGGCTCAAGGACTTGGTTCTTCTGAGGGATAGGCTTGAGGTGCAGGCTGGTCCGGCG
GGGGGCAGGCCATCGAGGGATTTCCCCCCTGACACTTGGGAGAGTTGGATCTTTCTCGAGAGCGCCAGACGAACC
ATCATCACGGCCTCTGCCTTCATGTCCATCTTTCACCTGTTAAAGGCGGAGCAGCCCGTGCCCGGCGTATGGATC
GAGCGTCAGAGCTTCACGGCGTCCAAGCACCTTTGGGAAGCCGGCAGCTCCGTCGACTTCTACCGCGCCTGGCGC
GAGAAGCCGCACTATTGGGTCGAGAACTCGGGCTTCAGGGACTTGTGGATGTACGCCCGGCCTGCCGACTTGGAC
GAATTTACGAGGCTCATGCTCACGCCGTACGTCGGTGTCGATGCCATGGAGCACTTTATGGAGGGCGATTTCGTC
ATGCCTCTA
Transcript >Ophio5|6712
ATGTCCGTCTTGCTCGCTTGGCTCAAGGACTTGGTTCTTCTGAGGGATAGGCTTGAGGTGCAGGCTGGTCCGGCG
GGGGGCAGGCCATCGAGGGATTTCCCCCCTGACACTTGGGAGAGTTGGATCTTTCTCGAGAGCGCCAGACGAACC
ATCATCACGGCCTCTGCCTTCATGTCCATCTTTCACCTGTTAAAGGCGGAGCAGCCCGTGCCCGGCGTATGGATC
GAGCGTCAGAGCTTCACGGCGTCCAAGCACCTTTGGGAAGCCGGCAGCTCCGTCGACTTCTACCGCGCCTGGCGC
GAGAAGCCGCACTATTGGGTCGAGAACTCGGGCTTCAGGGACTTGTGGATGTACGCCCGGCCTGCCGACTTGGAC
GAATTTACGAGGCTCATGCTCACGCCGTACGTCGGTGTCGATGCCATGGAGCACTTTATGGAGGGCGATTTCGTC
ATGCCTCTATGA
Gene >Ophio5|6712
ATGTCCGTCTTGCTCGCTTGGCTCAAGGACTTGGTTCTTCTGAGGGATAGGCTTGAGGTGCAGGCTGGTCCGGCG
GGGGGCAGGCCATCGAGGGATTTCCCCCCTGACACTTGGGAGGTTTGTTTCCTGTTTCTTGTCATTTCTTCTTCT
TCTTCTTCCCCTGTCTTTCCTCCTTTGCTGACGAGAGCCTCTGTTTTCGGGCTGTCAGAGTTGGATCTTTCTCGA
GAGCGCCAGACGAACCATCATCACGGCCTCTGCCTTCATGTCCATCTTTCACCTGTTAAAGGCGGAGCAGCGTAC
GTCTTTGATCCCCCCCCCTCCCCCTTTACCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCCCCCCC
CCCTTTCTAACACCCCGTGAGAATCCAGCCGTGCCCGGCGTATGGATCGAGCGTCAGAGCTTCACGGCGTCCAAG
CACCTTTGGGAAGCCGGCAGCTCCGTCGACTTCTACCGCGCCTGGCGCGAGAAGCCGCACTATTGGGTCGAGAAC
TCGGGCTTCAGGGACTTGTGGATGTACGCCCGGCCTGCCGACTTGGACGAATTTACGAGGCTCATGCTCACGCCG
TAAGTTCTTTCCCCTCCCCCTTCTTGAGGAGTCTGTCTCGCTAACATGCATCTCCCGCGTTGCGTTTAGGTACGT
CGGTGTCGATGCCATGGAGCACTTTATGGAGGGCGATTTCGTCATGCCTCTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail