Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6698
Gene name
Locationscaffold_6:81335..81875
Strand+
Gene length (bp)540
Transcript length (bp)540
Coding sequence length (bp)537
Protein length (aa) 179

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 2.34 0.0 4.92
CcL In ants, during behavior modification 0.00 0.0 0.00
CcD In ants, recently dead 0.11 0.0 0.68

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.236303 no
CcL CcD 1.000000 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6698
MRYDAIALVLALASFALAIPTELSDQGQSITSETHLFRRAAACSICCLKRKLCIKAKLCGCADEPAPAPAPVEDG
GRRIIVVNGGNGGNGGGGGAGFGEGSGFGGGFGNGGGFGNGGGFGNGGGGGFGNGGGGGFGNGGGGGFGNGGGFG
GGSGGGGGGGFGGGGGNGGGSFHTFSFRT
Coding >Ophio5|6698
ATGAGGTACGACGCCATTGCCCTCGTGCTCGCACTAGCCAGCTTCGCGCTCGCCATCCCGACCGAGTTGTCAGAT
CAGGGTCAATCCATCACTTCGGAGACTCACCTCTTCCGACGAGCGGCCGCCTGCTCCATCTGCTGCCTCAAGAGA
AAGCTCTGCATCAAGGCTAAGCTCTGCGGCTGTGCTGACGAGCCCGCTCCCGCGCCCGCGCCCGTGGAGGATGGA
GGCCGCCGCATCATCGTCGTCAATGGAGGCAACGGAGGTAATGGAGGTGGTGGTGGCGCTGGCTTCGGTGAGGGT
AGTGGTTTCGGTGGCGGCTTCGGCAACGGTGGTGGGTTCGGTAACGGTGGTGGATTCGGCAACGGCGGCGGCGGT
GGATTCGGCAACGGTGGCGGCGGAGGATTCGGCAACGGTGGCGGCGGAGGATTCGGTAACGGTGGTGGTTTCGGA
GGCGGATCCGGCGGTGGCGGTGGTGGTGGCTTCGGCGGCGGCGGCGGAAACGGTGGTGGCAGCTTCCACACCTTT
AGCTTCCGTACC
Transcript >Ophio5|6698
ATGAGGTACGACGCCATTGCCCTCGTGCTCGCACTAGCCAGCTTCGCGCTCGCCATCCCGACCGAGTTGTCAGAT
CAGGGTCAATCCATCACTTCGGAGACTCACCTCTTCCGACGAGCGGCCGCCTGCTCCATCTGCTGCCTCAAGAGA
AAGCTCTGCATCAAGGCTAAGCTCTGCGGCTGTGCTGACGAGCCCGCTCCCGCGCCCGCGCCCGTGGAGGATGGA
GGCCGCCGCATCATCGTCGTCAATGGAGGCAACGGAGGTAATGGAGGTGGTGGTGGCGCTGGCTTCGGTGAGGGT
AGTGGTTTCGGTGGCGGCTTCGGCAACGGTGGTGGGTTCGGTAACGGTGGTGGATTCGGCAACGGCGGCGGCGGT
GGATTCGGCAACGGTGGCGGCGGAGGATTCGGCAACGGTGGCGGCGGAGGATTCGGTAACGGTGGTGGTTTCGGA
GGCGGATCCGGCGGTGGCGGTGGTGGTGGCTTCGGCGGCGGCGGCGGAAACGGTGGTGGCAGCTTCCACACCTTT
AGCTTCCGTACCTAA
Gene >Ophio5|6698
ATGAGGTACGACGCCATTGCCCTCGTGCTCGCACTAGCCAGCTTCGCGCTCGCCATCCCGACCGAGTTGTCAGAT
CAGGGTCAATCCATCACTTCGGAGACTCACCTCTTCCGACGAGCGGCCGCCTGCTCCATCTGCTGCCTCAAGAGA
AAGCTCTGCATCAAGGCTAAGCTCTGCGGCTGTGCTGACGAGCCCGCTCCCGCGCCCGCGCCCGTGGAGGATGGA
GGCCGCCGCATCATCGTCGTCAATGGAGGCAACGGAGGTAATGGAGGTGGTGGTGGCGCTGGCTTCGGTGAGGGT
AGTGGTTTCGGTGGCGGCTTCGGCAACGGTGGTGGGTTCGGTAACGGTGGTGGATTCGGCAACGGCGGCGGCGGT
GGATTCGGCAACGGTGGCGGCGGAGGATTCGGCAACGGTGGCGGCGGAGGATTCGGTAACGGTGGTGGTTTCGGA
GGCGGATCCGGCGGTGGCGGTGGTGGTGGCTTCGGCGGCGGCGGCGGAAACGGTGGTGGCAGCTTCCACACCTTT
AGCTTCCGTACCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail