Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|669
Gene name
Locationscaffold_118:33794..34628
Strand+
Gene length (bp)834
Transcript length (bp)753
Coding sequence length (bp)750
Protein length (aa) 250

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10256 Erf4 Golgin subfamily A member 7/ERF4 family 5.0E-35 101 225

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.5162 0.6197 0.0275 0.0702 0.1749 0.0057 0.2529 0.294 0.2279 0.0613

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5828
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|567
Ophiocordyceps australis map64 (Brazil) OphauB2|177
Ophiocordyceps camponoti-floridani Ophcf2|04916
Ophiocordyceps camponoti-rufipedis Ophun1|5777
Ophiocordyceps kimflemingae Ophio5|669 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|669
MTPDGRRSSSRDLEQQQQQQQLQQRPPPPVDMARPSSMLSTSGLGGGGGDGTLLSSAGSSIMGDDLVPDNGVDEW
GPQHPCYPHLNPHVPADSVEYVSTRIIRIRRDWLPHGDLAPTLSNLYPEILDPAGLSEHEFRRVIDKLNLELVDV
FNPYGFRNVVDALLGVVTGWLWDDFGFTAIKKRLDRLERWIDGWNRDMEKTVAADESVTPPKMISLRQTAYMTLD
IQIADPEIAPAPSSVAAGESRSSLP
Coding >Ophio5|669
ATGACGCCCGACGGGCGACGCTCCTCGTCCCGCGACCTGGAGCAGCAGCAGCAGCAGCAGCAGCTGCAGCAGCGG
CCACCGCCGCCGGTAGACATGGCGCGTCCATCGTCGATGCTGTCGACGTCCGGCCTCGGCGGCGGCGGTGGGGAC
GGAACGCTCCTGTCGTCCGCCGGCTCATCGATCATGGGCGACGACCTCGTCCCCGACAACGGCGTCGACGAATGG
GGCCCTCAACACCCATGTTATCCGCACCTCAACCCGCACGTGCCCGCCGATTCGGTCGAGTACGTGTCGACGCGC
ATCATCCGCATCCGCCGCGACTGGCTCCCGCACGGGGACCTGGCTCCGACGCTGTCGAACCTGTATCCCGAGATC
CTCGACCCGGCTGGCTTGTCGGAGCACGAATTTCGTCGCGTCATCGATAAGCTAAACCTCGAACTCGTCGACGTC
TTTAACCCGTATGGCTTTCGCAACGTCGTCGACGCCTTGCTCGGCGTCGTCACCGGCTGGCTGTGGGACGACTTC
GGCTTCACCGCCATCAAGAAGCGTCTTGATCGCCTCGAGCGCTGGATTGATGGCTGGAACCGCGACATGGAGAAG
ACCGTCGCCGCTGACGAGAGCGTTACGCCCCCCAAAATGATTTCGCTACGGCAGACGGCCTACATGACGCTCGAT
ATCCAAATAGCGGACCCTGAAATAGCGCCGGCACCCAGCAGCGTCGCCGCCGGCGAGTCGCGCTCCTCCTTACCA
Transcript >Ophio5|669
ATGACGCCCGACGGGCGACGCTCCTCGTCCCGCGACCTGGAGCAGCAGCAGCAGCAGCAGCAGCTGCAGCAGCGG
CCACCGCCGCCGGTAGACATGGCGCGTCCATCGTCGATGCTGTCGACGTCCGGCCTCGGCGGCGGCGGTGGGGAC
GGAACGCTCCTGTCGTCCGCCGGCTCATCGATCATGGGCGACGACCTCGTCCCCGACAACGGCGTCGACGAATGG
GGCCCTCAACACCCATGTTATCCGCACCTCAACCCGCACGTGCCCGCCGATTCGGTCGAGTACGTGTCGACGCGC
ATCATCCGCATCCGCCGCGACTGGCTCCCGCACGGGGACCTGGCTCCGACGCTGTCGAACCTGTATCCCGAGATC
CTCGACCCGGCTGGCTTGTCGGAGCACGAATTTCGTCGCGTCATCGATAAGCTAAACCTCGAACTCGTCGACGTC
TTTAACCCGTATGGCTTTCGCAACGTCGTCGACGCCTTGCTCGGCGTCGTCACCGGCTGGCTGTGGGACGACTTC
GGCTTCACCGCCATCAAGAAGCGTCTTGATCGCCTCGAGCGCTGGATTGATGGCTGGAACCGCGACATGGAGAAG
ACCGTCGCCGCTGACGAGAGCGTTACGCCCCCCAAAATGATTTCGCTACGGCAGACGGCCTACATGACGCTCGAT
ATCCAAATAGCGGACCCTGAAATAGCGCCGGCACCCAGCAGCGTCGCCGCCGGCGAGTCGCGCTCCTCCTTACCA
TAA
Gene >Ophio5|669
ATGACGCCCGACGGGCGACGCTCCTCGTCCCGCGACCTGGAGCAGCAGCAGCAGCAGCAGCAGCTGCAGCAGCGG
CCACCGCCGCCGGTAGACATGGCGCGTCCATCGTCGATGCTGTCGACGTCCGGCCTCGGCGGCGGCGGTGGGGAC
GGAACGCTCCTGTCGTCCGCCGGCTCATCGATCATGGGCGACGACCTCGTCCCCGACAACGGCGTCGACGAATGG
GGCCCTCAACACCCATGTTATCCGCACCTCAACCCGCACGTGCCCGCCGATTCGGTCGAGTACGTGTCGACGCGC
ATCATCCGCATCCGCCGCGACTGGCTCCCGCACGGGGACCTGGCTCCGACGCTGTCGAACCTGTATCCCGAGATC
CTCGACCCGGCTGGCTTGTCGGAGCACGAATTTCGTCGCGTCATCGATAAGCTAAACCTCGAACTCGTCGACGTC
TTTAACCCGTATGGCTTTCGCAACGTCGTCGACGCCTTGCTCGGCGTCGTCACCGGCTGGCTGTGGGACGACTTC
GGCTTCACCGCCATCAAGAAGCGTCTTGATCGCCTCGAGCGCTGGATTGATGGCTGGAACCGCGACATGGAGAAG
ACCGTCGCCGCTGACGAGAGCGTTACGCCCCCCAAAATGATTTCGCTACGGCAGACGGCCTACATGACGGTGAGG
AGCTCTCGCTCTTTTTTTCTTCTTTTCTAGCCGCCGAATGCTGCTGACCCTTCGGCTCTCTCCTCCTCCTCCCAG
CTCGATATCCAAATAGCGGACCCTGAAATAGCGCCGGCACCCAGCAGCGTCGCCGCCGGCGAGTCGCGCTCCTCC
TTACCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail