Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6689
Gene name
Locationscaffold_6:60171..61062
Strand-
Gene length (bp)891
Transcript length (bp)891
Coding sequence length (bp)888
Protein length (aa) 296

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.1699 0.2669 0.5189 0.3341 0.4116 0.0707 0.1775 0.3657 0.2731 0.0022

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.15 0.00 0.52
CcL In ants, during behavior modification 9.46 1.54 17.39
CcD In ants, recently dead 6.49 1.51 11.48

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.198956 no
SC16a CcD 0.198956 no
CcL CcD 0.375491 no

Orthologs

Orthofinder run ID4
Orthogroup6496
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|07014
Ophiocordyceps camponoti-rufipedis Ophun1|223
Ophiocordyceps kimflemingae Ophio5|6689 (this protein)
Ophiocordyceps subramaniannii Hirsu2|106

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6689
MGLSASKFNGTEHATLANYACRPLTPTSSVPVLVTWTEWSKTSVLVTTNEPYRQISWVRYLLQTLPSELVDDFAA
ASNTTLKWYTEGLYISYEANKEAFNDVLLDLHDYSRYSGQVCWPKAKLNELVSGYHTKMGALLHLVVPKRSLFGN
WSAISFPSAPRDQFMDTSTYCMSLTDPYFHDIEAAITWQMSKWYSFKTQSAASNMNAAENIFMPYSHPFIKAFAK
SFQEGYECSSTAGCVSWPVRGETWIPKDMWKMHETIAELLRRRSDFCIMLGHQGPRDKFITVNTYAKGTWP
Coding >Ophio5|6689
ATGGGTCTTTCTGCATCCAAATTCAACGGCACTGAACATGCCACGTTAGCCAACTACGCGTGTCGTCCCTTAACA
CCTACTTCGTCGGTGCCCGTCCTGGTGACGTGGACAGAATGGAGCAAGACCTCCGTACTCGTCACGACCAACGAA
CCGTATCGTCAGATAAGCTGGGTCAGGTACTTGTTGCAGACACTGCCTTCTGAACTGGTAGATGACTTTGCTGCC
GCCTCTAACACCACTTTGAAGTGGTACACCGAGGGCCTCTACATCAGCTACGAGGCGAACAAAGAAGCCTTTAAT
GACGTTTTGCTTGACCTCCATGACTACAGCCGATATTCCGGCCAGGTGTGTTGGCCCAAGGCCAAACTCAACGAG
CTTGTCTCCGGATACCACACGAAGATGGGCGCCCTGCTTCACCTCGTGGTACCCAAACGATCATTATTTGGAAAC
TGGTCCGCCATATCGTTTCCCAGCGCCCCTAGAGACCAGTTCATGGATACCAGTACGTATTGCATGTCGCTAACC
GACCCTTATTTCCATGACATCGAGGCCGCCATTACCTGGCAAATGAGCAAATGGTACTCTTTCAAGACGCAGAGT
GCCGCCAGCAACATGAACGCCGCCGAGAATATTTTCATGCCTTACAGCCATCCCTTCATCAAGGCCTTTGCCAAG
AGTTTCCAGGAAGGGTATGAATGCTCTTCGACGGCCGGCTGTGTATCATGGCCCGTGCGGGGCGAGACTTGGATT
CCGAAAGACATGTGGAAGATGCACGAAACGATTGCAGAGCTGCTCAGAAGGCGATCCGACTTTTGCATCATGCTG
GGCCACCAAGGGCCGCGCGACAAGTTCATCACGGTGAATACTTACGCAAAGGGTACTTGGCCA
Transcript >Ophio5|6689
ATGGGTCTTTCTGCATCCAAATTCAACGGCACTGAACATGCCACGTTAGCCAACTACGCGTGTCGTCCCTTAACA
CCTACTTCGTCGGTGCCCGTCCTGGTGACGTGGACAGAATGGAGCAAGACCTCCGTACTCGTCACGACCAACGAA
CCGTATCGTCAGATAAGCTGGGTCAGGTACTTGTTGCAGACACTGCCTTCTGAACTGGTAGATGACTTTGCTGCC
GCCTCTAACACCACTTTGAAGTGGTACACCGAGGGCCTCTACATCAGCTACGAGGCGAACAAAGAAGCCTTTAAT
GACGTTTTGCTTGACCTCCATGACTACAGCCGATATTCCGGCCAGGTGTGTTGGCCCAAGGCCAAACTCAACGAG
CTTGTCTCCGGATACCACACGAAGATGGGCGCCCTGCTTCACCTCGTGGTACCCAAACGATCATTATTTGGAAAC
TGGTCCGCCATATCGTTTCCCAGCGCCCCTAGAGACCAGTTCATGGATACCAGTACGTATTGCATGTCGCTAACC
GACCCTTATTTCCATGACATCGAGGCCGCCATTACCTGGCAAATGAGCAAATGGTACTCTTTCAAGACGCAGAGT
GCCGCCAGCAACATGAACGCCGCCGAGAATATTTTCATGCCTTACAGCCATCCCTTCATCAAGGCCTTTGCCAAG
AGTTTCCAGGAAGGGTATGAATGCTCTTCGACGGCCGGCTGTGTATCATGGCCCGTGCGGGGCGAGACTTGGATT
CCGAAAGACATGTGGAAGATGCACGAAACGATTGCAGAGCTGCTCAGAAGGCGATCCGACTTTTGCATCATGCTG
GGCCACCAAGGGCCGCGCGACAAGTTCATCACGGTGAATACTTACGCAAAGGGTACTTGGCCATAG
Gene >Ophio5|6689
ATGGGTCTTTCTGCATCCAAATTCAACGGCACTGAACATGCCACGTTAGCCAACTACGCGTGTCGTCCCTTAACA
CCTACTTCGTCGGTGCCCGTCCTGGTGACGTGGACAGAATGGAGCAAGACCTCCGTACTCGTCACGACCAACGAA
CCGTATCGTCAGATAAGCTGGGTCAGGTACTTGTTGCAGACACTGCCTTCTGAACTGGTAGATGACTTTGCTGCC
GCCTCTAACACCACTTTGAAGTGGTACACCGAGGGCCTCTACATCAGCTACGAGGCGAACAAAGAAGCCTTTAAT
GACGTTTTGCTTGACCTCCATGACTACAGCCGATATTCCGGCCAGGTGTGTTGGCCCAAGGCCAAACTCAACGAG
CTTGTCTCCGGATACCACACGAAGATGGGCGCCCTGCTTCACCTCGTGGTACCCAAACGATCATTATTTGGAAAC
TGGTCCGCCATATCGTTTCCCAGCGCCCCTAGAGACCAGTTCATGGATACCAGTACGTATTGCATGTCGCTAACC
GACCCTTATTTCCATGACATCGAGGCCGCCATTACCTGGCAAATGAGCAAATGGTACTCTTTCAAGACGCAGAGT
GCCGCCAGCAACATGAACGCCGCCGAGAATATTTTCATGCCTTACAGCCATCCCTTCATCAAGGCCTTTGCCAAG
AGTTTCCAGGAAGGGTATGAATGCTCTTCGACGGCCGGCTGTGTATCATGGCCCGTGCGGGGCGAGACTTGGATT
CCGAAAGACATGTGGAAGATGCACGAAACGATTGCAGAGCTGCTCAGAAGGCGATCCGACTTTTGCATCATGCTG
GGCCACCAAGGGCCGCGCGACAAGTTCATCACGGTGAATACTTACGCAAAGGGTACTTGGCCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail