Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6688
Gene name
Locationscaffold_6:58153..59614
Strand-
Gene length (bp)1461
Transcript length (bp)1461
Coding sequence length (bp)1458
Protein length (aa) 486

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.8E-25 60 426
PF00083 Sugar_tr Sugar (and other) transporter 2.0E-08 87 200

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 25 440 3.0E-32
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 45 440 6.0E-26
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 58 438 2.0E-20
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 45 246 4.0E-20
sp|D8MQN9|MDTG_ERWBE Multidrug resistance protein MdtG OS=Erwinia billingiae (strain Eb661) GN=mdtG PE=3 SV=1 62 210 1.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 25 440 3.0E-32
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 45 440 6.0E-26
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 58 438 2.0E-20
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 45 246 4.0E-20
sp|D8MQN9|MDTG_ERWBE Multidrug resistance protein MdtG OS=Erwinia billingiae (strain Eb661) GN=mdtG PE=3 SV=1 62 210 1.0E-11
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 81 207 5.0E-11
sp|P51563|TCR7_VIBAN Tetracycline resistance protein, class G OS=Vibrio anguillarum GN=tetA PE=3 SV=1 82 343 1.0E-10
sp|B4EYY4|MDTG_PROMH Multidrug resistance protein MdtG OS=Proteus mirabilis (strain HI4320) GN=mdtG PE=3 SV=1 38 201 1.0E-09
sp|P33733|TCR4_SALOR Tetracycline resistance protein, class D OS=Salmonella ordonez GN=tetA PE=3 SV=1 67 207 2.0E-09
sp|P51564|TCR8_PASMD Tetracycline resistance protein, class H OS=Pasteurella multocida GN=tetA PE=3 SV=1 78 210 2.0E-09
sp|A8GCZ5|MDTG_SERP5 Multidrug resistance protein MdtG OS=Serratia proteamaculans (strain 568) GN=mdtG PE=3 SV=1 63 201 4.0E-09
sp|D2BX50|MDTG_DICD5 Multidrug resistance protein MdtG OS=Dickeya dadantii (strain Ech586) GN=mdtG PE=3 SV=1 63 156 5.0E-08
sp|Q07282|TCR5_ECOLX Tetracycline resistance protein, class E OS=Escherichia coli GN=tetA PE=3 SV=1 81 349 8.0E-08
sp|E3GC98|MDTG_ENTLS Multidrug resistance protein MdtG OS=Enterobacter lignolyticus (strain SCF1) GN=mdtG PE=3 SV=1 63 210 1.0E-07
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 67 197 3.0E-07
sp|P40760|YUXJ_BACSU Uncharacterized MFS-type transporter YuxJ OS=Bacillus subtilis (strain 168) GN=yuxJ PE=3 SV=3 67 256 1.0E-06
sp|A7ZZ10|MDTG_ECOHS Multidrug resistance protein MdtG OS=Escherichia coli O9:H4 (strain HS) GN=mdtG PE=3 SV=1 63 343 2.0E-06
sp|P0A0J4|NORA_STAAM Quinolone resistance protein NorA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=norA PE=3 SV=1 49 212 2.0E-06
sp|P0A0J5|NORA_STAAN Quinolone resistance protein NorA OS=Staphylococcus aureus (strain N315) GN=norA PE=3 SV=1 49 212 2.0E-06
sp|P0A0J7|NORA_STAAU Quinolone resistance protein NorA OS=Staphylococcus aureus GN=norA PE=3 SV=1 49 212 2.0E-06
sp|Q6GIU7|NORA_STAAR Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MRSA252) GN=norA PE=3 SV=1 49 212 2.0E-06
sp|Q6GBD5|NORA_STAAS Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MSSA476) GN=norA PE=3 SV=1 49 212 2.0E-06
sp|Q5HHX4|NORA_STAAC Quinolone resistance protein NorA OS=Staphylococcus aureus (strain COL) GN=norA PE=3 SV=1 49 212 2.0E-06
sp|Q14728|MFS10_HUMAN Major facilitator superfamily domain-containing protein 10 OS=Homo sapiens GN=MFSD10 PE=1 SV=1 89 199 2.0E-06
sp|P0A0J6|NORA_STAAW Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MW2) GN=norA PE=3 SV=1 49 212 2.0E-06
sp|B1IV49|MDTG_ECOLC Multidrug resistance protein MdtG OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtG PE=3 SV=1 63 343 4.0E-06
sp|B7UP67|MDTG_ECO27 Multidrug resistance protein MdtG OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtG PE=3 SV=1 63 343 4.0E-06
sp|B7MIJ4|MDTG_ECO45 Multidrug resistance protein MdtG OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtG PE=3 SV=1 63 343 4.0E-06
sp|A1A9U9|MDTG_ECOK1 Multidrug resistance protein MdtG OS=Escherichia coli O1:K1 / APEC GN=mdtG PE=3 SV=1 63 343 4.0E-06
sp|Q1RDA5|MDTG_ECOUT Multidrug resistance protein MdtG OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtG PE=3 SV=1 63 343 4.0E-06
sp|B7LFG4|MDTG_ECO55 Multidrug resistance protein MdtG OS=Escherichia coli (strain 55989 / EAEC) GN=mdtG PE=3 SV=1 63 343 4.0E-06
sp|A7ZKF6|MDTG_ECO24 Multidrug resistance protein MdtG OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtG PE=3 SV=1 63 343 4.0E-06
sp|Q8X9I3|MDTG_ECO57 Multidrug resistance protein MdtG OS=Escherichia coli O157:H7 GN=mdtG PE=3 SV=2 63 343 4.0E-06
sp|B7M928|MDTG_ECO8A Multidrug resistance protein MdtG OS=Escherichia coli O8 (strain IAI1) GN=mdtG PE=3 SV=1 63 343 4.0E-06
sp|C4ZRZ3|MDTG_ECOBW Multidrug resistance protein MdtG OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtG PE=3 SV=1 63 343 4.0E-06
sp|B1X9G6|MDTG_ECODH Multidrug resistance protein MdtG OS=Escherichia coli (strain K12 / DH10B) GN=mdtG PE=3 SV=1 63 343 4.0E-06
sp|P25744|MDTG_ECOLI Multidrug resistance protein MdtG OS=Escherichia coli (strain K12) GN=mdtG PE=3 SV=1 63 343 4.0E-06
sp|B7NAS9|MDTG_ECOLU Multidrug resistance protein MdtG OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtG PE=3 SV=1 63 343 4.0E-06
sp|B6I9D0|MDTG_ECOSE Multidrug resistance protein MdtG OS=Escherichia coli (strain SE11) GN=mdtG PE=3 SV=1 63 343 4.0E-06
sp|B5XXK2|MDTG_KLEP3 Multidrug resistance protein MdtG OS=Klebsiella pneumoniae (strain 342) GN=mdtG PE=3 SV=1 63 201 4.0E-06
sp|Q0TJ20|MDTG_ECOL5 Multidrug resistance protein MdtG OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtG PE=3 SV=1 63 343 4.0E-06
sp|Q8FIR9|MDTG_ECOL6 Multidrug resistance protein MdtG OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtG PE=3 SV=1 63 343 4.0E-06
sp|B7MTI5|MDTG_ECO81 Multidrug resistance protein MdtG OS=Escherichia coli O81 (strain ED1a) GN=mdtG PE=3 SV=1 63 343 4.0E-06
sp|B7NL82|MDTG_ECO7I Multidrug resistance protein MdtG OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtG PE=3 SV=1 63 343 4.0E-06
sp|B1LIV8|MDTG_ECOSM Multidrug resistance protein MdtG OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtG PE=3 SV=1 63 343 6.0E-06
sp|P02981|TCR3_ECOLX Tetracycline resistance protein, class C OS=Escherichia coli GN=tetA PE=1 SV=1 81 207 6.0E-06
sp|A1JN04|MDTG_YERE8 Multidrug resistance protein MdtG OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtG PE=3 SV=1 38 201 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

Domain # Start End Length
1 49 71 22
2 86 108 22
3 120 139 19
4 144 166 22
5 179 201 22
6 221 243 22
7 264 295 31
8 310 329 19
9 342 364 22
10 369 391 22
11 412 434 22
12 444 466 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6688
MASVPISGPLDSRPSDLQERHDEDASSETRPLLAGNGNKAPTARLPKGQIFLLCYARLAEPLAFFSIFPFIAQMV
QRNGHLAESDVGFYSGLIESCFSLAQMVCLLFWARLADRVGRKPVLVGTLMGMAVGPTLFGLATSLQQMFIFRSV
TGVLSGSGLIVRTAIGDHSTPETRAVAYSWFGFAGNLGVLLGPLVGGALAEPAKNMPGLFGGVGLFVEHPYVLSG
LAVSVIIAVAALASAVGLEETLNRKEMSREETNLSMRQLVAAPGVAAALGIYAHVMLLAFVFAAILPLALYTPVA
LGGMACSSAAISAYMAVQGASQALWLVLVFPRLQRRIGTKRVLRLCGFFYPFFFGGFVLMNALLRQDKRALFWIV
GGLVATIGPGVNMGSTCVQLIIQDVSPDARYVGVMNALALTLASAIRSFAPAVSTAIFAFGVRNHILFGHLAWAL
LIPLSAALIAMSALVSDETARPESNSDEETSVMHQR
Coding >Ophio5|6688
ATGGCCTCCGTCCCAATTTCAGGGCCTCTCGACTCCCGACCCTCCGACCTCCAGGAACGCCATGATGAAGACGCC
AGCTCCGAAACAAGGCCGCTGCTGGCAGGCAACGGCAACAAGGCGCCGACGGCGAGGCTCCCCAAGGGACAAATC
TTTCTCCTTTGCTACGCTCGCCTCGCCGAGCCCCTCGCCTTCTTCTCCATCTTCCCCTTTATAGCCCAGATGGTG
CAACGCAACGGCCACCTCGCCGAGTCAGACGTCGGCTTCTACAGCGGCCTCATTGAGAGCTGCTTCTCGCTCGCC
CAGATGGTCTGCCTGCTGTTCTGGGCCCGGCTGGCGGATCGAGTCGGACGTAAGCCTGTGCTGGTCGGCACGTTG
ATGGGCATGGCCGTTGGACCGACGCTATTCGGCCTCGCTACCAGTCTTCAACAAATGTTCATCTTCCGCTCCGTG
ACCGGCGTCCTCTCCGGGTCCGGTCTCATCGTCCGTACCGCCATCGGCGATCATAGCACGCCCGAGACGCGGGCC
GTGGCCTACAGCTGGTTCGGCTTTGCCGGCAACCTCGGCGTGCTTCTCGGCCCGTTGGTGGGCGGCGCGCTGGCC
GAGCCGGCAAAAAACATGCCCGGCCTGTTCGGAGGCGTCGGCTTGTTCGTCGAGCACCCGTATGTGCTGTCCGGG
CTGGCCGTTTCCGTCATCATCGCCGTTGCGGCCCTGGCTTCAGCCGTGGGCCTCGAGGAAACGCTCAATCGCAAA
GAGATGAGTCGTGAGGAGACCAACCTGTCCATGAGGCAGCTTGTCGCTGCTCCAGGTGTCGCAGCGGCGCTCGGA
ATCTATGCGCATGTGATGCTGCTAGCCTTTGTCTTTGCCGCTATCCTGCCTCTTGCGCTGTACACTCCCGTGGCT
CTAGGCGGCATGGCTTGCTCTTCCGCCGCCATCTCAGCTTATATGGCGGTCCAGGGCGCCAGCCAAGCACTGTGG
CTGGTCCTCGTCTTCCCGCGGTTGCAGCGGCGCATTGGGACGAAGCGTGTTCTTCGTCTGTGCGGCTTCTTCTAC
CCCTTTTTCTTCGGGGGCTTTGTTCTCATGAACGCGCTGTTGCGGCAAGACAAACGTGCCCTCTTCTGGATTGTT
GGCGGCCTCGTGGCGACTATTGGCCCTGGGGTCAATATGGGCTCGACTTGCGTTCAGCTCATCATACAAGATGTC
TCCCCTGATGCTCGTTACGTGGGCGTCATGAACGCTCTGGCCTTGACTCTGGCGAGCGCTATTCGGTCATTTGCG
CCGGCCGTGTCGACTGCCATCTTTGCCTTTGGCGTGCGAAATCATATCTTGTTTGGACACCTCGCCTGGGCGCTC
CTGATTCCACTCTCCGCAGCGCTGATCGCCATGTCGGCGTTGGTGTCGGACGAGACGGCGCGGCCCGAGTCGAAC
TCGGATGAAGAGACTTCAGTAATGCATCAACGA
Transcript >Ophio5|6688
ATGGCCTCCGTCCCAATTTCAGGGCCTCTCGACTCCCGACCCTCCGACCTCCAGGAACGCCATGATGAAGACGCC
AGCTCCGAAACAAGGCCGCTGCTGGCAGGCAACGGCAACAAGGCGCCGACGGCGAGGCTCCCCAAGGGACAAATC
TTTCTCCTTTGCTACGCTCGCCTCGCCGAGCCCCTCGCCTTCTTCTCCATCTTCCCCTTTATAGCCCAGATGGTG
CAACGCAACGGCCACCTCGCCGAGTCAGACGTCGGCTTCTACAGCGGCCTCATTGAGAGCTGCTTCTCGCTCGCC
CAGATGGTCTGCCTGCTGTTCTGGGCCCGGCTGGCGGATCGAGTCGGACGTAAGCCTGTGCTGGTCGGCACGTTG
ATGGGCATGGCCGTTGGACCGACGCTATTCGGCCTCGCTACCAGTCTTCAACAAATGTTCATCTTCCGCTCCGTG
ACCGGCGTCCTCTCCGGGTCCGGTCTCATCGTCCGTACCGCCATCGGCGATCATAGCACGCCCGAGACGCGGGCC
GTGGCCTACAGCTGGTTCGGCTTTGCCGGCAACCTCGGCGTGCTTCTCGGCCCGTTGGTGGGCGGCGCGCTGGCC
GAGCCGGCAAAAAACATGCCCGGCCTGTTCGGAGGCGTCGGCTTGTTCGTCGAGCACCCGTATGTGCTGTCCGGG
CTGGCCGTTTCCGTCATCATCGCCGTTGCGGCCCTGGCTTCAGCCGTGGGCCTCGAGGAAACGCTCAATCGCAAA
GAGATGAGTCGTGAGGAGACCAACCTGTCCATGAGGCAGCTTGTCGCTGCTCCAGGTGTCGCAGCGGCGCTCGGA
ATCTATGCGCATGTGATGCTGCTAGCCTTTGTCTTTGCCGCTATCCTGCCTCTTGCGCTGTACACTCCCGTGGCT
CTAGGCGGCATGGCTTGCTCTTCCGCCGCCATCTCAGCTTATATGGCGGTCCAGGGCGCCAGCCAAGCACTGTGG
CTGGTCCTCGTCTTCCCGCGGTTGCAGCGGCGCATTGGGACGAAGCGTGTTCTTCGTCTGTGCGGCTTCTTCTAC
CCCTTTTTCTTCGGGGGCTTTGTTCTCATGAACGCGCTGTTGCGGCAAGACAAACGTGCCCTCTTCTGGATTGTT
GGCGGCCTCGTGGCGACTATTGGCCCTGGGGTCAATATGGGCTCGACTTGCGTTCAGCTCATCATACAAGATGTC
TCCCCTGATGCTCGTTACGTGGGCGTCATGAACGCTCTGGCCTTGACTCTGGCGAGCGCTATTCGGTCATTTGCG
CCGGCCGTGTCGACTGCCATCTTTGCCTTTGGCGTGCGAAATCATATCTTGTTTGGACACCTCGCCTGGGCGCTC
CTGATTCCACTCTCCGCAGCGCTGATCGCCATGTCGGCGTTGGTGTCGGACGAGACGGCGCGGCCCGAGTCGAAC
TCGGATGAAGAGACTTCAGTAATGCATCAACGATAG
Gene >Ophio5|6688
ATGGCCTCCGTCCCAATTTCAGGGCCTCTCGACTCCCGACCCTCCGACCTCCAGGAACGCCATGATGAAGACGCC
AGCTCCGAAACAAGGCCGCTGCTGGCAGGCAACGGCAACAAGGCGCCGACGGCGAGGCTCCCCAAGGGACAAATC
TTTCTCCTTTGCTACGCTCGCCTCGCCGAGCCCCTCGCCTTCTTCTCCATCTTCCCCTTTATAGCCCAGATGGTG
CAACGCAACGGCCACCTCGCCGAGTCAGACGTCGGCTTCTACAGCGGCCTCATTGAGAGCTGCTTCTCGCTCGCC
CAGATGGTCTGCCTGCTGTTCTGGGCCCGGCTGGCGGATCGAGTCGGACGTAAGCCTGTGCTGGTCGGCACGTTG
ATGGGCATGGCCGTTGGACCGACGCTATTCGGCCTCGCTACCAGTCTTCAACAAATGTTCATCTTCCGCTCCGTG
ACCGGCGTCCTCTCCGGGTCCGGTCTCATCGTCCGTACCGCCATCGGCGATCATAGCACGCCCGAGACGCGGGCC
GTGGCCTACAGCTGGTTCGGCTTTGCCGGCAACCTCGGCGTGCTTCTCGGCCCGTTGGTGGGCGGCGCGCTGGCC
GAGCCGGCAAAAAACATGCCCGGCCTGTTCGGAGGCGTCGGCTTGTTCGTCGAGCACCCGTATGTGCTGTCCGGG
CTGGCCGTTTCCGTCATCATCGCCGTTGCGGCCCTGGCTTCAGCCGTGGGCCTCGAGGAAACGCTCAATCGCAAA
GAGATGAGTCGTGAGGAGACCAACCTGTCCATGAGGCAGCTTGTCGCTGCTCCAGGTGTCGCAGCGGCGCTCGGA
ATCTATGCGCATGTGATGCTGCTAGCCTTTGTCTTTGCCGCTATCCTGCCTCTTGCGCTGTACACTCCCGTGGCT
CTAGGCGGCATGGCTTGCTCTTCCGCCGCCATCTCAGCTTATATGGCGGTCCAGGGCGCCAGCCAAGCACTGTGG
CTGGTCCTCGTCTTCCCGCGGTTGCAGCGGCGCATTGGGACGAAGCGTGTTCTTCGTCTGTGCGGCTTCTTCTAC
CCCTTTTTCTTCGGGGGCTTTGTTCTCATGAACGCGCTGTTGCGGCAAGACAAACGTGCCCTCTTCTGGATTGTT
GGCGGCCTCGTGGCGACTATTGGCCCTGGGGTCAATATGGGCTCGACTTGCGTTCAGCTCATCATACAAGATGTC
TCCCCTGATGCTCGTTACGTGGGCGTCATGAACGCTCTGGCCTTGACTCTGGCGAGCGCTATTCGGTCATTTGCG
CCGGCCGTGTCGACTGCCATCTTTGCCTTTGGCGTGCGAAATCATATCTTGTTTGGACACCTCGCCTGGGCGCTC
CTGATTCCACTCTCCGCAGCGCTGATCGCCATGTCGGCGTTGGTGTCGGACGAGACGGCGCGGCCCGAGTCGAAC
TCGGATGAAGAGACTTCAGTAATGCATCAACGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail