Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6687
Gene name
Locationscaffold_6:56588..57950
Strand+
Gene length (bp)1362
Transcript length (bp)1362
Coding sequence length (bp)1359
Protein length (aa) 453

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01062 Bestrophin Bestrophin, RFP-TM, chloride channel 1.9E-41 51 370

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P72926|Y1024_SYNY3 UPF0187 protein sll1024 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1024 PE=3 SV=2 53 377 1.0E-29
sp|Q8YSU5|Y2987_NOSS1 UPF0187 protein alr2987 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2987 PE=3 SV=1 45 382 2.0E-29
sp|Q8ZPI0|YNEE_SALTY UPF0187 protein YneE OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yneE PE=3 SV=2 53 386 2.0E-23
sp|Q8Z706|YNEE_SALTI UPF0187 protein YneE OS=Salmonella typhi GN=yneE PE=3 SV=2 53 386 2.0E-23
sp|Q8XAZ3|YNEE_ECO57 UPF0187 protein YneE OS=Escherichia coli O157:H7 GN=yneE PE=3 SV=2 58 376 2.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P72926|Y1024_SYNY3 UPF0187 protein sll1024 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1024 PE=3 SV=2 53 377 1.0E-29
sp|Q8YSU5|Y2987_NOSS1 UPF0187 protein alr2987 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2987 PE=3 SV=1 45 382 2.0E-29
sp|Q8ZPI0|YNEE_SALTY UPF0187 protein YneE OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yneE PE=3 SV=2 53 386 2.0E-23
sp|Q8Z706|YNEE_SALTI UPF0187 protein YneE OS=Salmonella typhi GN=yneE PE=3 SV=2 53 386 2.0E-23
sp|Q8XAZ3|YNEE_ECO57 UPF0187 protein YneE OS=Escherichia coli O157:H7 GN=yneE PE=3 SV=2 58 376 2.0E-21
sp|P76146|YNEE_ECOLI UPF0187 protein YneE OS=Escherichia coli (strain K12) GN=yneE PE=3 SV=2 58 376 8.0E-21
sp|Q98E66|Y4386_RHILO UPF0187 protein mll4386 OS=Rhizobium loti (strain MAFF303099) GN=mll4386 PE=3 SV=1 53 369 1.0E-16
sp|Q8XTY1|Y3414_RALSO UPF0187 protein RSc3414 OS=Ralstonia solanacearum (strain GMI1000) GN=RSc3414 PE=3 SV=1 270 367 1.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0005254 chloride channel activity Yes
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015267 channel activity No
GO:0022857 transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0008509 anion transmembrane transporter activity No
GO:0015108 chloride transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0005253 anion channel activity No
GO:0005216 ion channel activity No
GO:0022803 passive transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

Domain # Start End Length
1 53 75 22
2 90 109 19
3 295 317 22
4 327 349 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6687
MDDGGKPESPRSPVSATPPPGPETSARHHGSGLDLNDYFTGPRDMARHSRWPLLLRLHGSILPKLILPIALLSIW
STAITVVSIKVHPLGVHSVLLTLTGFVVSLSLSFRCSTAYERYSEGRKYWTALVQASHVLGRVFWIHAKDVPDMD
PREGLLLRLSSMNLVVAFALALKHGLRFEPYVYQDLSQLVDHLNTFAAAATDADLRNDTRRPRHRRFFHSVGEYL
GLSFTASNPRKALKRASRPLGHLPLEILGHLAIAIDALVADQQLTVPAHQTLAYNALQSLNDVMTGTERVLCTPL
PIAYSIAISQATYLYLALLPFQLIPLLHWIAVPATIAASCIILSLLFIGQEIEDPFGHDVNDLPLDSYCDQIAAD
MDIIASIDTRDPRAFLTSRRNVPLHPVSTAPYDVWMQRDEEKLRDAVRQKPVARFEWKKWGNAKANSFASNTSIE
QKV
Coding >Ophio5|6687
ATGGACGACGGCGGCAAGCCCGAGTCGCCCCGCAGCCCCGTCTCAGCCACTCCACCTCCCGGCCCTGAAACCTCG
GCCCGCCATCACGGCTCGGGCCTTGATCTCAATGACTATTTTACTGGTCCGCGCGATATGGCGCGTCACAGCCGG
TGGCCGCTCCTGCTACGGCTCCACGGCAGCATCCTGCCGAAACTCATCCTTCCCATCGCCCTCCTTAGCATCTGG
AGCACGGCCATCACGGTCGTCTCCATCAAGGTGCACCCTTTGGGCGTCCACTCCGTGCTGTTGACGCTCACCGGC
TTCGTCGTCTCGCTTTCACTCTCGTTTCGCTGCTCGACCGCCTACGAACGTTACTCTGAGGGACGCAAGTATTGG
ACTGCCCTCGTCCAGGCCTCACACGTCCTCGGCCGTGTCTTCTGGATCCACGCAAAAGATGTGCCGGATATGGAT
CCTCGCGAGGGGCTGTTGTTACGTCTATCGTCGATGAACCTGGTTGTCGCCTTCGCCCTCGCCCTGAAGCACGGC
CTGCGCTTCGAGCCGTATGTCTACCAAGATCTCTCTCAACTGGTCGACCATCTCAACACGTTTGCGGCCGCGGCA
ACAGACGCCGATTTGAGAAATGATACTCGTCGCCCTCGCCATCGCCGCTTCTTCCACAGCGTCGGCGAATATCTA
GGCCTGTCATTTACTGCAAGCAACCCGCGCAAGGCCCTCAAGCGCGCCTCGCGACCCCTAGGCCACCTTCCCCTA
GAAATTCTTGGCCATCTCGCCATCGCCATCGATGCCCTCGTCGCTGACCAGCAGCTCACCGTCCCGGCGCATCAG
ACGTTGGCTTACAACGCCCTACAGTCGCTCAACGATGTCATGACGGGCACAGAGCGCGTCCTCTGCACGCCCCTG
CCCATTGCCTATTCCATCGCCATCTCCCAAGCCACCTACCTCTATCTCGCCCTGCTGCCCTTCCAGCTGATTCCC
CTGTTGCATTGGATTGCCGTACCCGCTACGATCGCTGCGTCCTGCATCATCCTCAGCCTCCTCTTCATCGGCCAA
GAGATCGAAGACCCATTCGGACACGATGTCAACGACCTGCCCCTTGACAGCTACTGCGACCAGATTGCCGCCGAT
ATGGACATCATTGCCTCGATCGACACCCGCGACCCGCGCGCCTTTCTCACCAGCCGCCGCAATGTGCCGCTTCAT
CCGGTCAGCACGGCGCCTTACGACGTCTGGATGCAGCGCGATGAGGAGAAGCTACGTGACGCTGTCCGACAGAAG
CCCGTTGCCAGGTTCGAGTGGAAGAAATGGGGGAACGCCAAGGCCAACAGCTTTGCGAGCAACACCAGCATTGAG
CAAAAAGTC
Transcript >Ophio5|6687
ATGGACGACGGCGGCAAGCCCGAGTCGCCCCGCAGCCCCGTCTCAGCCACTCCACCTCCCGGCCCTGAAACCTCG
GCCCGCCATCACGGCTCGGGCCTTGATCTCAATGACTATTTTACTGGTCCGCGCGATATGGCGCGTCACAGCCGG
TGGCCGCTCCTGCTACGGCTCCACGGCAGCATCCTGCCGAAACTCATCCTTCCCATCGCCCTCCTTAGCATCTGG
AGCACGGCCATCACGGTCGTCTCCATCAAGGTGCACCCTTTGGGCGTCCACTCCGTGCTGTTGACGCTCACCGGC
TTCGTCGTCTCGCTTTCACTCTCGTTTCGCTGCTCGACCGCCTACGAACGTTACTCTGAGGGACGCAAGTATTGG
ACTGCCCTCGTCCAGGCCTCACACGTCCTCGGCCGTGTCTTCTGGATCCACGCAAAAGATGTGCCGGATATGGAT
CCTCGCGAGGGGCTGTTGTTACGTCTATCGTCGATGAACCTGGTTGTCGCCTTCGCCCTCGCCCTGAAGCACGGC
CTGCGCTTCGAGCCGTATGTCTACCAAGATCTCTCTCAACTGGTCGACCATCTCAACACGTTTGCGGCCGCGGCA
ACAGACGCCGATTTGAGAAATGATACTCGTCGCCCTCGCCATCGCCGCTTCTTCCACAGCGTCGGCGAATATCTA
GGCCTGTCATTTACTGCAAGCAACCCGCGCAAGGCCCTCAAGCGCGCCTCGCGACCCCTAGGCCACCTTCCCCTA
GAAATTCTTGGCCATCTCGCCATCGCCATCGATGCCCTCGTCGCTGACCAGCAGCTCACCGTCCCGGCGCATCAG
ACGTTGGCTTACAACGCCCTACAGTCGCTCAACGATGTCATGACGGGCACAGAGCGCGTCCTCTGCACGCCCCTG
CCCATTGCCTATTCCATCGCCATCTCCCAAGCCACCTACCTCTATCTCGCCCTGCTGCCCTTCCAGCTGATTCCC
CTGTTGCATTGGATTGCCGTACCCGCTACGATCGCTGCGTCCTGCATCATCCTCAGCCTCCTCTTCATCGGCCAA
GAGATCGAAGACCCATTCGGACACGATGTCAACGACCTGCCCCTTGACAGCTACTGCGACCAGATTGCCGCCGAT
ATGGACATCATTGCCTCGATCGACACCCGCGACCCGCGCGCCTTTCTCACCAGCCGCCGCAATGTGCCGCTTCAT
CCGGTCAGCACGGCGCCTTACGACGTCTGGATGCAGCGCGATGAGGAGAAGCTACGTGACGCTGTCCGACAGAAG
CCCGTTGCCAGGTTCGAGTGGAAGAAATGGGGGAACGCCAAGGCCAACAGCTTTGCGAGCAACACCAGCATTGAG
CAAAAAGTCTGA
Gene >Ophio5|6687
ATGGACGACGGCGGCAAGCCCGAGTCGCCCCGCAGCCCCGTCTCAGCCACTCCACCTCCCGGCCCTGAAACCTCG
GCCCGCCATCACGGCTCGGGCCTTGATCTCAATGACTATTTTACTGGTCCGCGCGATATGGCGCGTCACAGCCGG
TGGCCGCTCCTGCTACGGCTCCACGGCAGCATCCTGCCGAAACTCATCCTTCCCATCGCCCTCCTTAGCATCTGG
AGCACGGCCATCACGGTCGTCTCCATCAAGGTGCACCCTTTGGGCGTCCACTCCGTGCTGTTGACGCTCACCGGC
TTCGTCGTCTCGCTTTCACTCTCGTTTCGCTGCTCGACCGCCTACGAACGTTACTCTGAGGGACGCAAGTATTGG
ACTGCCCTCGTCCAGGCCTCACACGTCCTCGGCCGTGTCTTCTGGATCCACGCAAAAGATGTGCCGGATATGGAT
CCTCGCGAGGGGCTGTTGTTACGTCTATCGTCGATGAACCTGGTTGTCGCCTTCGCCCTCGCCCTGAAGCACGGC
CTGCGCTTCGAGCCGTATGTCTACCAAGATCTCTCTCAACTGGTCGACCATCTCAACACGTTTGCGGCCGCGGCA
ACAGACGCCGATTTGAGAAATGATACTCGTCGCCCTCGCCATCGCCGCTTCTTCCACAGCGTCGGCGAATATCTA
GGCCTGTCATTTACTGCAAGCAACCCGCGCAAGGCCCTCAAGCGCGCCTCGCGACCCCTAGGCCACCTTCCCCTA
GAAATTCTTGGCCATCTCGCCATCGCCATCGATGCCCTCGTCGCTGACCAGCAGCTCACCGTCCCGGCGCATCAG
ACGTTGGCTTACAACGCCCTACAGTCGCTCAACGATGTCATGACGGGCACAGAGCGCGTCCTCTGCACGCCCCTG
CCCATTGCCTATTCCATCGCCATCTCCCAAGCCACCTACCTCTATCTCGCCCTGCTGCCCTTCCAGCTGATTCCC
CTGTTGCATTGGATTGCCGTACCCGCTACGATCGCTGCGTCCTGCATCATCCTCAGCCTCCTCTTCATCGGCCAA
GAGATCGAAGACCCATTCGGACACGATGTCAACGACCTGCCCCTTGACAGCTACTGCGACCAGATTGCCGCCGAT
ATGGACATCATTGCCTCGATCGACACCCGCGACCCGCGCGCCTTTCTCACCAGCCGCCGCAATGTGCCGCTTCAT
CCGGTCAGCACGGCGCCTTACGACGTCTGGATGCAGCGCGATGAGGAGAAGCTACGTGACGCTGTCCGACAGAAG
CCCGTTGCCAGGTTCGAGTGGAAGAAATGGGGGAACGCCAAGGCCAACAGCTTTGCGAGCAACACCAGCATTGAG
CAAAAAGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail