Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6681
Gene name
Locationscaffold_6:38449..42238
Strand-
Gene length (bp)3789
Transcript length (bp)3789
Coding sequence length (bp)3786
Protein length (aa) 1262

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05183 RdRP RNA dependent RNA polymerase 8.3E-112 410 1065

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7XM31|RDR2_ORYSJ Probable RNA-dependent RNA polymerase 2 OS=Oryza sativa subsp. japonica GN=RDR2 PE=2 SV=1 532 916 2.0E-19
sp|Q8LHH9|SHL2_ORYSJ Probable RNA-dependent RNA polymerase SHL2 OS=Oryza sativa subsp. japonica GN=SHL2 PE=2 SV=1 419 916 3.0E-17
sp|Q9LQV2|RDR1_ARATH RNA-dependent RNA polymerase 1 OS=Arabidopsis thaliana GN=RDR1 PE=2 SV=1 591 953 5.0E-16
sp|Q0DXS3|RDR1_ORYSJ Probable RNA-dependent RNA polymerase 1 OS=Oryza sativa subsp. japonica GN=RDR1 PE=2 SV=2 532 953 8.0E-16
sp|O14227|RDR1_SCHPO RNA-dependent RNA polymerase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rdr1 PE=1 SV=1 576 916 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7XM31|RDR2_ORYSJ Probable RNA-dependent RNA polymerase 2 OS=Oryza sativa subsp. japonica GN=RDR2 PE=2 SV=1 532 916 2.0E-19
sp|Q8LHH9|SHL2_ORYSJ Probable RNA-dependent RNA polymerase SHL2 OS=Oryza sativa subsp. japonica GN=SHL2 PE=2 SV=1 419 916 3.0E-17
sp|Q9LQV2|RDR1_ARATH RNA-dependent RNA polymerase 1 OS=Arabidopsis thaliana GN=RDR1 PE=2 SV=1 591 953 5.0E-16
sp|Q0DXS3|RDR1_ORYSJ Probable RNA-dependent RNA polymerase 1 OS=Oryza sativa subsp. japonica GN=RDR1 PE=2 SV=2 532 953 8.0E-16
sp|O14227|RDR1_SCHPO RNA-dependent RNA polymerase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rdr1 PE=1 SV=1 576 916 2.0E-15
sp|Q9SG02|RDR6_ARATH RNA-dependent RNA polymerase 6 OS=Arabidopsis thaliana GN=RDR6 PE=1 SV=1 559 916 4.0E-13
sp|O82504|RDR2_ARATH RNA-dependent RNA polymerase 2 OS=Arabidopsis thaliana GN=RDR2 PE=1 SV=1 592 928 5.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0003968 RNA-directed 5'-3' RNA polymerase activity Yes
GO:0097747 RNA polymerase activity No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016779 nucleotidyltransferase activity No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0140098 catalytic activity, acting on RNA No
GO:0034062 5'-3' RNA polymerase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3601 0.8877 0.4786 0.0141 0.0887 0.0083 0.0314 0.0203 0.014 0.0038

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3623
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4865
Ophiocordyceps australis map64 (Brazil) OphauB2|262
Ophiocordyceps camponoti-floridani Ophcf2|07006
Ophiocordyceps camponoti-rufipedis Ophun1|672
Ophiocordyceps kimflemingae Ophio5|6681 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7000

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6681
MPPSDDQLQRIIASLNADYDLAICQPTPSLSPRNAKLLSGSDQDICLAEKLYRTLHWLHFNQSDRLSSLIGRFRQ
RASDQLGASVAFAGSAQRRRLLGNYLLHVLEESDPLPRQKRLSDDESESQKKRPKSREHVLGLDLVDQLPVRSSP
TPITNYFQRSRTIVGSSSFGMSSASSANTLESSRKSRTSSASTDNSLDSSRTAVTKYSTRTLSASTVTSVNSRET
TFVNPPKDVDEDDDDDDDEHFLISSQEFQDLADKLDGYDRVAAERPRPPSSMNEKFNSFWNRQSANNLDKASAKS
LEKGLKLLWPKLSFRGLDMAPLPVIWEVTRIFQHCKVEPGTCDLEYDEKWLDQRLLRKTLASHPSFAGKTLPAAS
AQEAWSVALGSFFSTKGRQVCLTAELVIRSGGKTVFPLALRLNPLKLEQSHRLSRRFGADRFLEINIPEPKMLKR
ELLKVNNGRDDVQVTFSRWLQSSGPHWFVGRLWVPYFFSKKGPKKAQGLALSRIYLFASDGNHFRMSSAGALPPP
EEALTPASRTKLTLEGLSHWAIGIKSPKNSAQPVVKLFSRWSLSHTRTWPTEELQRGQIRLQEEDVGTHSVMNDG
LGRISKALARKIAHHLEPYDKRNIPSSTAGYQGRIGSAKGFWIVDVESKPDDDDVWIEIYPSQVKWLCEFEDSCH
RTFEVKALAQEAKPGASLNVQFLPLLEAQAKDRVAMRRYVEQIFSASLIDELDTLKGSLSHGHDLLEWLNRNMQS
SSRELTMLAGLPDSKEDTVTFLVNAGFEPGRLKYMQELCRKIAEQKAETLKKKFRVPVPQSTNLFMVADFWGVLE
EGQVSVSFSTKFETDGFCDTALDNLQVLVARNPAHTLSDIQKVVAVAHPKLRELKDVIVFSTKGTTPLAALLSGG
DYDGDRCWVCWDRNIVDNFDAAPVAQSGHGSEGVKVDKMDITVDQLKQEGQNWRMICSEFAFTGFNFSMQPDMLG
ICTKYKEKLNYKWGVKGPHMARLSALLGELVDQAKQGIIFNDKSWEQFRREELRAPLWLEDPAYFNDKCTTSPEM
LDDDSSILDVLKFKVAQPAIDGALLRLKQSVESQKQPPQNFDEHLTAPYWYLDKKRRDYKAVHELLTGLRKDLDV
VCNEWRKRMGVREEDGDFGPRCEEVFALWKAISPRPEVQSSEKLQLLLDGWGQNPTMSRWTLLKASATFHMFHQT
QTEFAWRMAGCWLCYLKAEAVSRSMPPAVMQLPTYSCYRPSNKRLREDNAKRKGEEMMMMEE
Coding >Ophio5|6681
ATGCCTCCGTCTGATGATCAACTGCAGCGCATCATCGCTAGTCTCAACGCCGACTATGACCTCGCCATCTGCCAG
CCCACCCCGAGCCTATCGCCCCGAAATGCTAAACTGTTGAGCGGTTCGGACCAAGATATCTGTCTGGCGGAGAAA
CTGTACCGCACCCTTCACTGGCTTCACTTTAACCAGTCGGATCGTCTGTCTTCTCTCATCGGAAGGTTTCGTCAG
CGGGCTTCGGACCAACTCGGTGCGTCTGTCGCGTTCGCTGGGTCGGCTCAGAGGAGACGGCTTCTGGGGAATTAT
TTGTTGCATGTTTTGGAGGAGTCGGATCCCTTGCCACGACAGAAGAGGTTGTCGGATGATGAGAGCGAGTCCCAA
AAGAAGAGACCGAAATCTCGTGAGCATGTCTTGGGTCTTGATTTGGTTGATCAGCTTCCTGTGCGGAGTTCGCCT
ACTCCCATCACTAATTATTTCCAGAGGAGCCGCACCATTGTGGGAAGCTCTTCTTTCGGCATGTCGTCAGCTTCC
TCCGCCAATACTCTTGAGAGCAGCCGCAAATCCAGGACCTCGTCAGCTTCTACCGACAACTCTCTTGATAGCAGC
CGCACAGCCGTCACAAAATATTCTACCCGAACCTTGTCAGCCTCCACCGTCACCTCTGTCAACAGCCGAGAGACG
ACTTTTGTTAACCCACCCAAAGACGTTGACGAAGACGACGATGACGACGATGACGAGCATTTTCTCATCAGTTCA
CAGGAATTTCAAGACCTCGCCGATAAGTTGGACGGATACGACCGTGTTGCCGCGGAAAGGCCCCGTCCACCTTCG
TCAATGAATGAAAAGTTCAACAGCTTTTGGAATAGGCAGTCTGCCAACAACTTGGACAAAGCGTCCGCAAAGTCG
CTGGAGAAGGGGCTCAAGCTCCTGTGGCCCAAGCTGAGTTTCCGGGGCCTCGACATGGCTCCCTTGCCAGTCATT
TGGGAGGTCACGCGCATCTTTCAGCACTGCAAGGTCGAGCCCGGCACCTGCGACCTCGAGTACGACGAAAAGTGG
CTTGATCAACGGCTTCTACGCAAGACCTTGGCCAGCCACCCGTCCTTTGCGGGCAAGACTCTCCCTGCCGCCAGC
GCCCAGGAAGCGTGGTCAGTTGCCTTGGGCAGCTTCTTCTCAACGAAAGGCCGTCAAGTTTGCTTGACGGCCGAG
CTGGTGATCCGCTCCGGCGGTAAAACGGTGTTCCCCTTGGCGCTACGGCTGAACCCCTTGAAGCTGGAGCAAAGT
CATCGGCTTTCGCGACGCTTCGGTGCCGACCGCTTCCTCGAGATTAATATCCCAGAACCGAAAATGCTCAAAAGG
GAGCTCCTCAAGGTCAACAACGGCCGCGATGACGTTCAAGTGACGTTCAGCAGGTGGCTACAGTCTTCCGGCCCT
CACTGGTTCGTCGGCCGCCTCTGGGTTCCGTATTTCTTTTCGAAAAAGGGGCCCAAAAAGGCACAGGGGCTGGCC
TTGTCGAGGATATACCTTTTCGCCTCGGATGGCAACCACTTCCGCATGTCCTCTGCCGGCGCCCTGCCGCCCCCG
GAAGAGGCCTTGACGCCAGCGTCCCGCACAAAGCTGACGCTCGAGGGGCTCTCGCACTGGGCGATTGGTATAAAA
AGTCCAAAAAATTCGGCTCAGCCTGTCGTCAAGCTCTTTTCTCGATGGTCGCTCAGTCACACGCGGACCTGGCCG
ACCGAGGAGCTCCAACGGGGGCAAATCAGGTTGCAGGAAGAAGACGTGGGCACTCATAGCGTCATGAACGATGGC
TTGGGACGAATATCGAAAGCCTTGGCCCGGAAGATTGCCCATCACCTCGAACCGTACGACAAACGCAATATTCCC
TCAAGCACAGCCGGTTACCAGGGACGAATAGGCAGCGCCAAGGGCTTTTGGATCGTCGATGTCGAGTCGAAGCCC
GATGACGATGATGTTTGGATCGAGATCTACCCTTCACAGGTCAAGTGGCTTTGTGAATTTGAGGACAGCTGTCAT
AGGACGTTTGAAGTCAAGGCTCTGGCTCAGGAGGCCAAGCCGGGAGCTTCGCTGAATGTTCAGTTTCTTCCGCTG
CTGGAAGCCCAAGCCAAGGACCGAGTGGCCATGCGACGATATGTCGAACAAATCTTCAGTGCCAGTCTCATTGAC
GAGCTCGACACGCTGAAGGGGTCGTTGAGCCACGGCCACGACCTGTTGGAGTGGCTGAATCGAAACATGCAATCT
AGCTCCCGAGAACTGACAATGCTCGCCGGACTGCCGGACTCGAAAGAAGACACGGTCACTTTCTTGGTCAACGCC
GGCTTCGAGCCTGGACGGCTGAAATACATGCAGGAACTCTGCCGTAAGATTGCGGAACAGAAAGCCGAGACGCTG
AAGAAAAAGTTCCGCGTCCCCGTTCCACAGTCGACAAACCTGTTCATGGTGGCCGACTTTTGGGGCGTGCTGGAG
GAGGGACAAGTCTCGGTCAGCTTTTCGACCAAGTTTGAAACCGACGGTTTTTGTGACACGGCGCTCGACAACTTG
CAGGTGCTCGTGGCGAGGAATCCTGCTCACACCCTGTCCGATATACAAAAGGTCGTTGCCGTCGCGCACCCCAAA
CTCCGCGAATTGAAGGACGTCATCGTCTTCTCGACGAAAGGGACGACACCCCTGGCCGCTCTGCTCTCCGGGGGC
GACTACGACGGCGACAGATGCTGGGTCTGCTGGGATCGCAACATTGTCGACAACTTTGATGCTGCCCCGGTTGCC
CAGAGCGGCCATGGCTCGGAAGGGGTCAAAGTCGATAAGATGGATATAACGGTCGACCAGCTCAAGCAGGAAGGA
CAGAACTGGCGGATGATATGTTCCGAATTTGCCTTTACCGGCTTCAACTTTTCCATGCAGCCCGACATGCTGGGC
ATCTGCACAAAGTACAAGGAAAAGCTCAACTACAAGTGGGGAGTGAAGGGTCCGCACATGGCCAGGTTGAGCGCC
TTGCTCGGCGAACTCGTCGACCAGGCAAAGCAGGGCATCATCTTCAACGACAAAAGCTGGGAACAATTCCGCAGG
GAAGAGCTTCGTGCGCCGCTGTGGCTCGAAGACCCTGCTTATTTCAACGACAAGTGTACGACGTCACCCGAGATG
CTGGATGATGACAGTTCGATCCTCGACGTTCTCAAGTTCAAGGTTGCGCAGCCGGCCATCGACGGCGCGTTACTG
AGGCTGAAGCAGTCTGTGGAATCGCAAAAGCAGCCGCCACAAAACTTTGATGAGCACTTGACTGCGCCTTACTGG
TATTTGGACAAAAAGCGAAGGGATTACAAGGCCGTTCATGAGCTGTTGACCGGACTCAGGAAAGACCTCGACGTC
GTCTGCAATGAGTGGCGGAAGAGGATGGGCGTCCGCGAAGAGGACGGAGATTTTGGGCCACGTTGCGAAGAAGTC
TTTGCCTTGTGGAAGGCCATTTCGCCGCGGCCGGAGGTGCAGTCTTCGGAAAAGCTGCAGCTGCTTCTCGATGGC
TGGGGACAGAATCCGACGATGAGCAGATGGACCCTGCTCAAGGCCTCGGCGACGTTTCACATGTTTCACCAAACT
CAGACCGAGTTTGCGTGGCGGATGGCGGGTTGTTGGTTGTGCTATCTGAAGGCAGAAGCGGTGTCGAGGTCAATG
CCGCCTGCTGTGATGCAGCTGCCCACGTACAGCTGTTACCGGCCGTCGAACAAGAGGCTTCGGGAAGACAATGCG
AAGCGAAAAGGGGAGGAGATGATGATGATGGAAGAA
Transcript >Ophio5|6681
ATGCCTCCGTCTGATGATCAACTGCAGCGCATCATCGCTAGTCTCAACGCCGACTATGACCTCGCCATCTGCCAG
CCCACCCCGAGCCTATCGCCCCGAAATGCTAAACTGTTGAGCGGTTCGGACCAAGATATCTGTCTGGCGGAGAAA
CTGTACCGCACCCTTCACTGGCTTCACTTTAACCAGTCGGATCGTCTGTCTTCTCTCATCGGAAGGTTTCGTCAG
CGGGCTTCGGACCAACTCGGTGCGTCTGTCGCGTTCGCTGGGTCGGCTCAGAGGAGACGGCTTCTGGGGAATTAT
TTGTTGCATGTTTTGGAGGAGTCGGATCCCTTGCCACGACAGAAGAGGTTGTCGGATGATGAGAGCGAGTCCCAA
AAGAAGAGACCGAAATCTCGTGAGCATGTCTTGGGTCTTGATTTGGTTGATCAGCTTCCTGTGCGGAGTTCGCCT
ACTCCCATCACTAATTATTTCCAGAGGAGCCGCACCATTGTGGGAAGCTCTTCTTTCGGCATGTCGTCAGCTTCC
TCCGCCAATACTCTTGAGAGCAGCCGCAAATCCAGGACCTCGTCAGCTTCTACCGACAACTCTCTTGATAGCAGC
CGCACAGCCGTCACAAAATATTCTACCCGAACCTTGTCAGCCTCCACCGTCACCTCTGTCAACAGCCGAGAGACG
ACTTTTGTTAACCCACCCAAAGACGTTGACGAAGACGACGATGACGACGATGACGAGCATTTTCTCATCAGTTCA
CAGGAATTTCAAGACCTCGCCGATAAGTTGGACGGATACGACCGTGTTGCCGCGGAAAGGCCCCGTCCACCTTCG
TCAATGAATGAAAAGTTCAACAGCTTTTGGAATAGGCAGTCTGCCAACAACTTGGACAAAGCGTCCGCAAAGTCG
CTGGAGAAGGGGCTCAAGCTCCTGTGGCCCAAGCTGAGTTTCCGGGGCCTCGACATGGCTCCCTTGCCAGTCATT
TGGGAGGTCACGCGCATCTTTCAGCACTGCAAGGTCGAGCCCGGCACCTGCGACCTCGAGTACGACGAAAAGTGG
CTTGATCAACGGCTTCTACGCAAGACCTTGGCCAGCCACCCGTCCTTTGCGGGCAAGACTCTCCCTGCCGCCAGC
GCCCAGGAAGCGTGGTCAGTTGCCTTGGGCAGCTTCTTCTCAACGAAAGGCCGTCAAGTTTGCTTGACGGCCGAG
CTGGTGATCCGCTCCGGCGGTAAAACGGTGTTCCCCTTGGCGCTACGGCTGAACCCCTTGAAGCTGGAGCAAAGT
CATCGGCTTTCGCGACGCTTCGGTGCCGACCGCTTCCTCGAGATTAATATCCCAGAACCGAAAATGCTCAAAAGG
GAGCTCCTCAAGGTCAACAACGGCCGCGATGACGTTCAAGTGACGTTCAGCAGGTGGCTACAGTCTTCCGGCCCT
CACTGGTTCGTCGGCCGCCTCTGGGTTCCGTATTTCTTTTCGAAAAAGGGGCCCAAAAAGGCACAGGGGCTGGCC
TTGTCGAGGATATACCTTTTCGCCTCGGATGGCAACCACTTCCGCATGTCCTCTGCCGGCGCCCTGCCGCCCCCG
GAAGAGGCCTTGACGCCAGCGTCCCGCACAAAGCTGACGCTCGAGGGGCTCTCGCACTGGGCGATTGGTATAAAA
AGTCCAAAAAATTCGGCTCAGCCTGTCGTCAAGCTCTTTTCTCGATGGTCGCTCAGTCACACGCGGACCTGGCCG
ACCGAGGAGCTCCAACGGGGGCAAATCAGGTTGCAGGAAGAAGACGTGGGCACTCATAGCGTCATGAACGATGGC
TTGGGACGAATATCGAAAGCCTTGGCCCGGAAGATTGCCCATCACCTCGAACCGTACGACAAACGCAATATTCCC
TCAAGCACAGCCGGTTACCAGGGACGAATAGGCAGCGCCAAGGGCTTTTGGATCGTCGATGTCGAGTCGAAGCCC
GATGACGATGATGTTTGGATCGAGATCTACCCTTCACAGGTCAAGTGGCTTTGTGAATTTGAGGACAGCTGTCAT
AGGACGTTTGAAGTCAAGGCTCTGGCTCAGGAGGCCAAGCCGGGAGCTTCGCTGAATGTTCAGTTTCTTCCGCTG
CTGGAAGCCCAAGCCAAGGACCGAGTGGCCATGCGACGATATGTCGAACAAATCTTCAGTGCCAGTCTCATTGAC
GAGCTCGACACGCTGAAGGGGTCGTTGAGCCACGGCCACGACCTGTTGGAGTGGCTGAATCGAAACATGCAATCT
AGCTCCCGAGAACTGACAATGCTCGCCGGACTGCCGGACTCGAAAGAAGACACGGTCACTTTCTTGGTCAACGCC
GGCTTCGAGCCTGGACGGCTGAAATACATGCAGGAACTCTGCCGTAAGATTGCGGAACAGAAAGCCGAGACGCTG
AAGAAAAAGTTCCGCGTCCCCGTTCCACAGTCGACAAACCTGTTCATGGTGGCCGACTTTTGGGGCGTGCTGGAG
GAGGGACAAGTCTCGGTCAGCTTTTCGACCAAGTTTGAAACCGACGGTTTTTGTGACACGGCGCTCGACAACTTG
CAGGTGCTCGTGGCGAGGAATCCTGCTCACACCCTGTCCGATATACAAAAGGTCGTTGCCGTCGCGCACCCCAAA
CTCCGCGAATTGAAGGACGTCATCGTCTTCTCGACGAAAGGGACGACACCCCTGGCCGCTCTGCTCTCCGGGGGC
GACTACGACGGCGACAGATGCTGGGTCTGCTGGGATCGCAACATTGTCGACAACTTTGATGCTGCCCCGGTTGCC
CAGAGCGGCCATGGCTCGGAAGGGGTCAAAGTCGATAAGATGGATATAACGGTCGACCAGCTCAAGCAGGAAGGA
CAGAACTGGCGGATGATATGTTCCGAATTTGCCTTTACCGGCTTCAACTTTTCCATGCAGCCCGACATGCTGGGC
ATCTGCACAAAGTACAAGGAAAAGCTCAACTACAAGTGGGGAGTGAAGGGTCCGCACATGGCCAGGTTGAGCGCC
TTGCTCGGCGAACTCGTCGACCAGGCAAAGCAGGGCATCATCTTCAACGACAAAAGCTGGGAACAATTCCGCAGG
GAAGAGCTTCGTGCGCCGCTGTGGCTCGAAGACCCTGCTTATTTCAACGACAAGTGTACGACGTCACCCGAGATG
CTGGATGATGACAGTTCGATCCTCGACGTTCTCAAGTTCAAGGTTGCGCAGCCGGCCATCGACGGCGCGTTACTG
AGGCTGAAGCAGTCTGTGGAATCGCAAAAGCAGCCGCCACAAAACTTTGATGAGCACTTGACTGCGCCTTACTGG
TATTTGGACAAAAAGCGAAGGGATTACAAGGCCGTTCATGAGCTGTTGACCGGACTCAGGAAAGACCTCGACGTC
GTCTGCAATGAGTGGCGGAAGAGGATGGGCGTCCGCGAAGAGGACGGAGATTTTGGGCCACGTTGCGAAGAAGTC
TTTGCCTTGTGGAAGGCCATTTCGCCGCGGCCGGAGGTGCAGTCTTCGGAAAAGCTGCAGCTGCTTCTCGATGGC
TGGGGACAGAATCCGACGATGAGCAGATGGACCCTGCTCAAGGCCTCGGCGACGTTTCACATGTTTCACCAAACT
CAGACCGAGTTTGCGTGGCGGATGGCGGGTTGTTGGTTGTGCTATCTGAAGGCAGAAGCGGTGTCGAGGTCAATG
CCGCCTGCTGTGATGCAGCTGCCCACGTACAGCTGTTACCGGCCGTCGAACAAGAGGCTTCGGGAAGACAATGCG
AAGCGAAAAGGGGAGGAGATGATGATGATGGAAGAATGA
Gene >Ophio5|6681
ATGCCTCCGTCTGATGATCAACTGCAGCGCATCATCGCTAGTCTCAACGCCGACTATGACCTCGCCATCTGCCAG
CCCACCCCGAGCCTATCGCCCCGAAATGCTAAACTGTTGAGCGGTTCGGACCAAGATATCTGTCTGGCGGAGAAA
CTGTACCGCACCCTTCACTGGCTTCACTTTAACCAGTCGGATCGTCTGTCTTCTCTCATCGGAAGGTTTCGTCAG
CGGGCTTCGGACCAACTCGGTGCGTCTGTCGCGTTCGCTGGGTCGGCTCAGAGGAGACGGCTTCTGGGGAATTAT
TTGTTGCATGTTTTGGAGGAGTCGGATCCCTTGCCACGACAGAAGAGGTTGTCGGATGATGAGAGCGAGTCCCAA
AAGAAGAGACCGAAATCTCGTGAGCATGTCTTGGGTCTTGATTTGGTTGATCAGCTTCCTGTGCGGAGTTCGCCT
ACTCCCATCACTAATTATTTCCAGAGGAGCCGCACCATTGTGGGAAGCTCTTCTTTCGGCATGTCGTCAGCTTCC
TCCGCCAATACTCTTGAGAGCAGCCGCAAATCCAGGACCTCGTCAGCTTCTACCGACAACTCTCTTGATAGCAGC
CGCACAGCCGTCACAAAATATTCTACCCGAACCTTGTCAGCCTCCACCGTCACCTCTGTCAACAGCCGAGAGACG
ACTTTTGTTAACCCACCCAAAGACGTTGACGAAGACGACGATGACGACGATGACGAGCATTTTCTCATCAGTTCA
CAGGAATTTCAAGACCTCGCCGATAAGTTGGACGGATACGACCGTGTTGCCGCGGAAAGGCCCCGTCCACCTTCG
TCAATGAATGAAAAGTTCAACAGCTTTTGGAATAGGCAGTCTGCCAACAACTTGGACAAAGCGTCCGCAAAGTCG
CTGGAGAAGGGGCTCAAGCTCCTGTGGCCCAAGCTGAGTTTCCGGGGCCTCGACATGGCTCCCTTGCCAGTCATT
TGGGAGGTCACGCGCATCTTTCAGCACTGCAAGGTCGAGCCCGGCACCTGCGACCTCGAGTACGACGAAAAGTGG
CTTGATCAACGGCTTCTACGCAAGACCTTGGCCAGCCACCCGTCCTTTGCGGGCAAGACTCTCCCTGCCGCCAGC
GCCCAGGAAGCGTGGTCAGTTGCCTTGGGCAGCTTCTTCTCAACGAAAGGCCGTCAAGTTTGCTTGACGGCCGAG
CTGGTGATCCGCTCCGGCGGTAAAACGGTGTTCCCCTTGGCGCTACGGCTGAACCCCTTGAAGCTGGAGCAAAGT
CATCGGCTTTCGCGACGCTTCGGTGCCGACCGCTTCCTCGAGATTAATATCCCAGAACCGAAAATGCTCAAAAGG
GAGCTCCTCAAGGTCAACAACGGCCGCGATGACGTTCAAGTGACGTTCAGCAGGTGGCTACAGTCTTCCGGCCCT
CACTGGTTCGTCGGCCGCCTCTGGGTTCCGTATTTCTTTTCGAAAAAGGGGCCCAAAAAGGCACAGGGGCTGGCC
TTGTCGAGGATATACCTTTTCGCCTCGGATGGCAACCACTTCCGCATGTCCTCTGCCGGCGCCCTGCCGCCCCCG
GAAGAGGCCTTGACGCCAGCGTCCCGCACAAAGCTGACGCTCGAGGGGCTCTCGCACTGGGCGATTGGTATAAAA
AGTCCAAAAAATTCGGCTCAGCCTGTCGTCAAGCTCTTTTCTCGATGGTCGCTCAGTCACACGCGGACCTGGCCG
ACCGAGGAGCTCCAACGGGGGCAAATCAGGTTGCAGGAAGAAGACGTGGGCACTCATAGCGTCATGAACGATGGC
TTGGGACGAATATCGAAAGCCTTGGCCCGGAAGATTGCCCATCACCTCGAACCGTACGACAAACGCAATATTCCC
TCAAGCACAGCCGGTTACCAGGGACGAATAGGCAGCGCCAAGGGCTTTTGGATCGTCGATGTCGAGTCGAAGCCC
GATGACGATGATGTTTGGATCGAGATCTACCCTTCACAGGTCAAGTGGCTTTGTGAATTTGAGGACAGCTGTCAT
AGGACGTTTGAAGTCAAGGCTCTGGCTCAGGAGGCCAAGCCGGGAGCTTCGCTGAATGTTCAGTTTCTTCCGCTG
CTGGAAGCCCAAGCCAAGGACCGAGTGGCCATGCGACGATATGTCGAACAAATCTTCAGTGCCAGTCTCATTGAC
GAGCTCGACACGCTGAAGGGGTCGTTGAGCCACGGCCACGACCTGTTGGAGTGGCTGAATCGAAACATGCAATCT
AGCTCCCGAGAACTGACAATGCTCGCCGGACTGCCGGACTCGAAAGAAGACACGGTCACTTTCTTGGTCAACGCC
GGCTTCGAGCCTGGACGGCTGAAATACATGCAGGAACTCTGCCGTAAGATTGCGGAACAGAAAGCCGAGACGCTG
AAGAAAAAGTTCCGCGTCCCCGTTCCACAGTCGACAAACCTGTTCATGGTGGCCGACTTTTGGGGCGTGCTGGAG
GAGGGACAAGTCTCGGTCAGCTTTTCGACCAAGTTTGAAACCGACGGTTTTTGTGACACGGCGCTCGACAACTTG
CAGGTGCTCGTGGCGAGGAATCCTGCTCACACCCTGTCCGATATACAAAAGGTCGTTGCCGTCGCGCACCCCAAA
CTCCGCGAATTGAAGGACGTCATCGTCTTCTCGACGAAAGGGACGACACCCCTGGCCGCTCTGCTCTCCGGGGGC
GACTACGACGGCGACAGATGCTGGGTCTGCTGGGATCGCAACATTGTCGACAACTTTGATGCTGCCCCGGTTGCC
CAGAGCGGCCATGGCTCGGAAGGGGTCAAAGTCGATAAGATGGATATAACGGTCGACCAGCTCAAGCAGGAAGGA
CAGAACTGGCGGATGATATGTTCCGAATTTGCCTTTACCGGCTTCAACTTTTCCATGCAGCCCGACATGCTGGGC
ATCTGCACAAAGTACAAGGAAAAGCTCAACTACAAGTGGGGAGTGAAGGGTCCGCACATGGCCAGGTTGAGCGCC
TTGCTCGGCGAACTCGTCGACCAGGCAAAGCAGGGCATCATCTTCAACGACAAAAGCTGGGAACAATTCCGCAGG
GAAGAGCTTCGTGCGCCGCTGTGGCTCGAAGACCCTGCTTATTTCAACGACAAGTGTACGACGTCACCCGAGATG
CTGGATGATGACAGTTCGATCCTCGACGTTCTCAAGTTCAAGGTTGCGCAGCCGGCCATCGACGGCGCGTTACTG
AGGCTGAAGCAGTCTGTGGAATCGCAAAAGCAGCCGCCACAAAACTTTGATGAGCACTTGACTGCGCCTTACTGG
TATTTGGACAAAAAGCGAAGGGATTACAAGGCCGTTCATGAGCTGTTGACCGGACTCAGGAAAGACCTCGACGTC
GTCTGCAATGAGTGGCGGAAGAGGATGGGCGTCCGCGAAGAGGACGGAGATTTTGGGCCACGTTGCGAAGAAGTC
TTTGCCTTGTGGAAGGCCATTTCGCCGCGGCCGGAGGTGCAGTCTTCGGAAAAGCTGCAGCTGCTTCTCGATGGC
TGGGGACAGAATCCGACGATGAGCAGATGGACCCTGCTCAAGGCCTCGGCGACGTTTCACATGTTTCACCAAACT
CAGACCGAGTTTGCGTGGCGGATGGCGGGTTGTTGGTTGTGCTATCTGAAGGCAGAAGCGGTGTCGAGGTCAATG
CCGCCTGCTGTGATGCAGCTGCCCACGTACAGCTGTTACCGGCCGTCGAACAAGAGGCTTCGGGAAGACAATGCG
AAGCGAAAAGGGGAGGAGATGATGATGATGGAAGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail