Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6672
Gene name
Locationscaffold_6:20856..23225
Strand+
Gene length (bp)2369
Transcript length (bp)2115
Coding sequence length (bp)2112
Protein length (aa) 704

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 4.5E-06 28 93
PF05730 CFEM CFEM domain 2.7E-08 206 271

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A4J5X2|IF2_DESRM Translation initiation factor IF-2 OS=Desulfotomaculum reducens (strain MI-1) GN=infB PE=3 SV=1 473 633 4.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6672
MRSSTGALSFAALIRFVAANPSCLSITSQFPECAFSCVKEAASKVGCTNTEDLGCQCTPASSAAILATAQPCVVS
CGIEQAGPAIKAGSALCACVASATPSSVSASTTSQPLTSPSEMPKDTSSKPTHVSDQTTQPKETSQSSITSDTET
PEGPTTTSQPASTDSVVQSSPRSSLPSSSPTDTVPSPMTTAAPCGAGADCGAIASSAIPQCAQSCFTSNIPKVGC
EVSNYKCQCQPGAQESLSMLLVPCVATACPPDAIPSVIAGASSVCACATAAGGNCAQTGNPGVVVTKTEIEMTTV
TSCETDQTNPASSAETPPPSRSVVPEPSCGGQADCGAQTSVPQPSCIGQTDCGQEKPKPQPTESCSEMPQPSCPG
QEGCGEQKPTPQPPVVKPQPPSCSGQPDCQLEKPQPPAVKPPQPTSCSGQPDCQSEKPRPPVVNPQPPSCSGQPD
CQLEKPQPPVVNPQPPSCSGQPGCGQQQPSPQPQRPSPQPSGGQPQPPSPQPSGGQPQPPSPQPSGGQPQPPSCS
GQPGCEQQKPSPPPPSAQPQPPAGKPQPPAGEYKPPGGQPQPPSGQPQPPTGESKPPAGKPQPPAVRPQPPAEES
KPTPGQPQPCTGQPGCPSEKPTGSNPQTCTGQPGCKPSAKPTGEEAGLRWPLRRRLGGGRCGSVLGHGHGVVKRK
TVVSIDFTSRVNWFSRDVMIVSSGLRLFL
Coding >Ophio5|6672
ATGAGAAGCTCGACTGGTGCGTTGAGCTTTGCGGCTCTCATCCGCTTCGTCGCTGCCAACCCGTCATGCCTCAGC
ATAACCTCGCAGTTCCCAGAATGCGCCTTTTCGTGCGTCAAGGAAGCTGCGTCAAAGGTTGGCTGCACTAACACG
GAAGACCTTGGATGTCAGTGTACGCCCGCCAGTTCGGCGGCTATTCTCGCCACTGCTCAGCCTTGTGTCGTGAGC
TGCGGCATCGAGCAGGCTGGGCCGGCTATCAAGGCTGGTTCGGCCCTCTGTGCCTGTGTTGCCTCTGCCACTCCA
TCTTCCGTATCAGCTTCTACAACCTCGCAGCCTCTCACCAGCCCTTCCGAGATGCCCAAGGATACGTCGTCCAAG
CCGACACACGTCAGTGACCAAACGACTCAGCCAAAGGAGACGTCACAGTCGTCCATAACATCCGACACGGAGACC
CCTGAAGGACCAACAACGACCTCTCAGCCAGCTTCCACCGACAGCGTTGTCCAGTCGTCGCCGAGGAGCAGCCTC
CCCTCGTCATCCCCGACGGACACAGTCCCCTCGCCCATGACGACAGCAGCGCCCTGCGGCGCCGGAGCCGATTGC
GGCGCCATAGCAAGCTCGGCCATTCCTCAGTGCGCCCAGTCGTGCTTCACATCCAACATTCCCAAGGTCGGCTGC
GAAGTCTCCAACTACAAATGCCAATGTCAGCCCGGAGCTCAAGAGAGCCTGTCCATGCTTCTCGTCCCTTGTGTG
GCGACGGCCTGTCCCCCTGATGCCATCCCGTCCGTCATCGCCGGCGCCAGTTCCGTCTGTGCCTGTGCAACGGCA
GCTGGTGGCAACTGTGCCCAGACGGGAAATCCTGGCGTTGTTGTCACCAAGACGGAGATTGAGATGACTACTGTT
ACCTCGTGTGAGACGGACCAGACAAACCCGGCGAGCAGCGCCGAGACGCCTCCTCCCAGTCGGAGTGTCGTCCCG
GAGCCGTCGTGCGGTGGTCAGGCGGATTGTGGTGCTCAGACGTCTGTTCCTCAGCCGTCTTGCATTGGTCAGACC
GACTGTGGCCAGGAGAAGCCTAAGCCGCAACCGACGGAGAGCTGTAGCGAGATGCCTCAGCCTTCTTGCCCGGGA
CAGGAGGGCTGCGGGGAGCAGAAGCCCACGCCGCAACCGCCCGTTGTCAAGCCTCAGCCTCCATCCTGCAGTGGC
CAGCCAGACTGTCAACTCGAGAAACCCCAGCCGCCTGCGGTCAAGCCGCCTCAGCCTACGTCTTGCAGCGGACAG
CCAGACTGCCAGAGTGAGAAGCCCCGACCACCAGTGGTCAACCCTCAGCCGCCTTCTTGCAGTGGCCAGCCAGAC
TGTCAGCTCGAGAAACCTCAACCGCCAGTGGTCAACCCTCAACCGCCTTCTTGCAGCGGGCAGCCCGGCTGTGGA
CAGCAGCAACCCTCTCCTCAGCCTCAGCGGCCTTCGCCCCAGCCATCTGGTGGCCAACCTCAGCCGCCTTCGCCC
CAACCATCTGGTGGCCAGCCTCAGCCGCCTTCGCCCCAGCCATCTGGTGGCCAGCCTCAGCCGCCTTCGTGCAGT
GGACAGCCTGGATGTGAGCAACAGAAGCCGTCGCCTCCACCGCCTTCCGCCCAGCCTCAACCTCCAGCTGGCAAG
CCTCAACCTCCCGCTGGGGAATATAAGCCTCCTGGCGGTCAACCTCAACCGCCTTCCGGCCAGCCTCAACCTCCC
ACCGGGGAATCCAAGCCTCCTGCTGGCAAGCCCCAGCCTCCCGCAGTTCGACCTCAGCCTCCCGCCGAGGAATCC
AAGCCCACGCCCGGCCAACCCCAGCCCTGCACCGGCCAACCAGGCTGCCCGTCCGAGAAACCGACCGGCAGTAAC
CCCCAGACCTGCACAGGCCAGCCAGGCTGCAAGCCGTCGGCCAAACCTACAGGCGAAGAGGCCGGGCTCCGCTGG
CCGTTGCGGCGTCGGCTTGGTGGCGGGCGTTGTGGGAGCGTTTTGGGCCATGGTCATGGTGTTGTGAAACGAAAA
ACAGTCGTGTCGATAGATTTCACGAGTCGCGTAAATTGGTTTTCGCGCGATGTTATGATTGTGTCTTCTGGATTG
CGCCTTTTCCTC
Transcript >Ophio5|6672
ATGAGAAGCTCGACTGGTGCGTTGAGCTTTGCGGCTCTCATCCGCTTCGTCGCTGCCAACCCGTCATGCCTCAGC
ATAACCTCGCAGTTCCCAGAATGCGCCTTTTCGTGCGTCAAGGAAGCTGCGTCAAAGGTTGGCTGCACTAACACG
GAAGACCTTGGATGTCAGTGTACGCCCGCCAGTTCGGCGGCTATTCTCGCCACTGCTCAGCCTTGTGTCGTGAGC
TGCGGCATCGAGCAGGCTGGGCCGGCTATCAAGGCTGGTTCGGCCCTCTGTGCCTGTGTTGCCTCTGCCACTCCA
TCTTCCGTATCAGCTTCTACAACCTCGCAGCCTCTCACCAGCCCTTCCGAGATGCCCAAGGATACGTCGTCCAAG
CCGACACACGTCAGTGACCAAACGACTCAGCCAAAGGAGACGTCACAGTCGTCCATAACATCCGACACGGAGACC
CCTGAAGGACCAACAACGACCTCTCAGCCAGCTTCCACCGACAGCGTTGTCCAGTCGTCGCCGAGGAGCAGCCTC
CCCTCGTCATCCCCGACGGACACAGTCCCCTCGCCCATGACGACAGCAGCGCCCTGCGGCGCCGGAGCCGATTGC
GGCGCCATAGCAAGCTCGGCCATTCCTCAGTGCGCCCAGTCGTGCTTCACATCCAACATTCCCAAGGTCGGCTGC
GAAGTCTCCAACTACAAATGCCAATGTCAGCCCGGAGCTCAAGAGAGCCTGTCCATGCTTCTCGTCCCTTGTGTG
GCGACGGCCTGTCCCCCTGATGCCATCCCGTCCGTCATCGCCGGCGCCAGTTCCGTCTGTGCCTGTGCAACGGCA
GCTGGTGGCAACTGTGCCCAGACGGGAAATCCTGGCGTTGTTGTCACCAAGACGGAGATTGAGATGACTACTGTT
ACCTCGTGTGAGACGGACCAGACAAACCCGGCGAGCAGCGCCGAGACGCCTCCTCCCAGTCGGAGTGTCGTCCCG
GAGCCGTCGTGCGGTGGTCAGGCGGATTGTGGTGCTCAGACGTCTGTTCCTCAGCCGTCTTGCATTGGTCAGACC
GACTGTGGCCAGGAGAAGCCTAAGCCGCAACCGACGGAGAGCTGTAGCGAGATGCCTCAGCCTTCTTGCCCGGGA
CAGGAGGGCTGCGGGGAGCAGAAGCCCACGCCGCAACCGCCCGTTGTCAAGCCTCAGCCTCCATCCTGCAGTGGC
CAGCCAGACTGTCAACTCGAGAAACCCCAGCCGCCTGCGGTCAAGCCGCCTCAGCCTACGTCTTGCAGCGGACAG
CCAGACTGCCAGAGTGAGAAGCCCCGACCACCAGTGGTCAACCCTCAGCCGCCTTCTTGCAGTGGCCAGCCAGAC
TGTCAGCTCGAGAAACCTCAACCGCCAGTGGTCAACCCTCAACCGCCTTCTTGCAGCGGGCAGCCCGGCTGTGGA
CAGCAGCAACCCTCTCCTCAGCCTCAGCGGCCTTCGCCCCAGCCATCTGGTGGCCAACCTCAGCCGCCTTCGCCC
CAACCATCTGGTGGCCAGCCTCAGCCGCCTTCGCCCCAGCCATCTGGTGGCCAGCCTCAGCCGCCTTCGTGCAGT
GGACAGCCTGGATGTGAGCAACAGAAGCCGTCGCCTCCACCGCCTTCCGCCCAGCCTCAACCTCCAGCTGGCAAG
CCTCAACCTCCCGCTGGGGAATATAAGCCTCCTGGCGGTCAACCTCAACCGCCTTCCGGCCAGCCTCAACCTCCC
ACCGGGGAATCCAAGCCTCCTGCTGGCAAGCCCCAGCCTCCCGCAGTTCGACCTCAGCCTCCCGCCGAGGAATCC
AAGCCCACGCCCGGCCAACCCCAGCCCTGCACCGGCCAACCAGGCTGCCCGTCCGAGAAACCGACCGGCAGTAAC
CCCCAGACCTGCACAGGCCAGCCAGGCTGCAAGCCGTCGGCCAAACCTACAGGCGAAGAGGCCGGGCTCCGCTGG
CCGTTGCGGCGTCGGCTTGGTGGCGGGCGTTGTGGGAGCGTTTTGGGCCATGGTCATGGTGTTGTGAAACGAAAA
ACAGTCGTGTCGATAGATTTCACGAGTCGCGTAAATTGGTTTTCGCGCGATGTTATGATTGTGTCTTCTGGATTG
CGCCTTTTCCTCTAA
Gene >Ophio5|6672
ATGAGAAGCTCGACTGGTGCGTTGAGCTTTGCGGCTCTCATCCGCTTCGTCGCTGCCAACCCGTCATGCCTCAGC
ATAACCTCGCAGTTCCCAGAATGCGCCGTATGTTGTATTGCTCTTTCTATCGAGCGACCAAAAGGTGGCTGACGT
GTCCTAGTTTTCGTGCGTCAAGGAAGCTGCGTCAAAGGTTGGCTGCACTAACACGGAAGACCTTGGATGTAAGTC
CCATCCCTCGTGTAAAGAGGCGCAAGGGACAGCTCGCTCATTGTCTACAGGTCAGTGTACGCCCGCCAGTTCGGC
GGCTATTCTCGCCACTGCTCAGCCTTGTGTCGTGAGCTGCGGCATCGAGCAGGCTGGGCCGGCTATCAAGGCTGG
TTCGGCCCTCTGTGCCTGTGTTGCCTCTGCCACTCCATCTTCCGTATCAGCTTCTACAACCTCGCAGCCTCTCAC
CAGCCCTTCCGAGATGCCCAAGGATACGTCGTCCAAGCCGACACACGTCAGTGACCAAACGACTCAGCCAAAGGA
GACGTCACAGTCGTCCATAACATCCGACACGGAGACCCCTGAAGGACCAACAACGACCTCTCAGCCAGCTTCCAC
CGACAGCGTTGTCCAGTCGTCGCCGAGGAGCAGCCTCCCCTCGTCATCCCCGACGGACACAGTCCCCTCGCCCAT
GACGACAGCAGCGCCCTGCGGCGCCGGAGCCGATTGCGGCGCCATAGCAAGCTCGGCCATTCCTCAGTGCGCCCA
GTCGTGCTTCACATCCAACATTCCCAAGGTCGGCTGCGAAGTCTCCAACTACAAATGCCAATGTCAGCCCGGAGC
TCAAGAGAGCCTGTCCATGCTTCTCGTCCCTTGTGTGGCGACGGCCTGTCCCCCTGATGCCATCCCGTCCGTCAT
CGCCGGCGCCAGTTCCGTCTGTGCCTGTGCAACGGCAGCTGGTGGCAACTGTGCCCAGACGGGAAATCCTGGCGT
TGTTGTCACCAAGACGGAGATTGAGATGACTACTGTTACCTCGTGTGAGACGGACCAGACAAACCCGGCGAGCAG
CGCCGAGACGCCTCCTCCCAGTCGGAGTGTCGTCCCGGAGCCGTCGTGCGGTGGTCAGGCGGATTGTGGTGCTCA
GACGTCTGTTCCTCAGCCGTCTTGCATTGGTCAGACCGACTGTGGCCAGGAGAAGCCTAAGCCGCAACCGACGGA
GAGCTGTAGCGAGATGCCTCAGCCTTCTTGCCCGGGACAGGAGGGCTGCGGGGAGCAGAAGCCCACGCCGCAACC
GCCCGTTGTCAAGCCTCAGCCTCCATCCTGCAGTGGCCAGCCAGACTGTCAACTCGAGAAACCCCAGCCGCCTGC
GGTCAAGCCGCCTCAGCCTACGTCTTGCAGCGGACAGCCAGACTGCCAGAGTGAGAAGCCCCGACCACCAGTGGT
CAACCCTCAGCCGCCTTCTTGCAGTGGCCAGCCAGACTGTCAGCTCGAGAAACCTCAACCGCCAGTGGTCAACCC
TCAACCGCCTTCTTGCAGCGGGCAGCCCGGCTGTGGACAGCAGCAACCCTCTCCTCAGCCTCAGCGGCCTTCGCC
CCAGCCATCTGGTGGCCAACCTCAGCCGCCTTCGCCCCAACCATCTGGTGGCCAGCCTCAGCCGCCTTCGCCCCA
GCCATCTGGTGGCCAGCCTCAGCCGCCTTCGTGCAGTGGACAGCCTGGATGTGAGCAACAGAAGCCGTCGCCTCC
ACCGCCTTCCGCCCAGCCTCAACCTCCAGCTGGCAAGCCTCAACCTCCCGCTGGGGAATATAAGCCTCCTGGCGG
TCAACCTCAACCGCCTTCCGGCCAGCCTCAACCTCCCACCGGGGAATCCAAGCCTCCTGCTGGCAAGCCCCAGCC
TCCCGCAGTTCGACCTCAGCCTCCCGCCGAGGAATCCAAGCCCACGCCCGGCCAACCCCAGCCCTGCACCGGCCA
ACCAGGCTGCCCGTCCGAGAAACCGACCGGCAGTAACCCCCAGACCTGCACAGGCCAGCCAGGCTGCAAGCCGTC
GGCCAAACCTACAGGCGAAGAGGGTAAGCCAACAACGGGTGGACAAGAGGGCAAGCCGACCAACGTCTCGCCGCC
GCCGAATAAGACGGCGCCTCCCGTCGTCCAGCCGGGCTCCGCTGGCCGTTGCGGCGTCGGCTTGGTGGCGGGCGT
TGTGGGAGCGTTTTGGGCCATGGTCATGGTGTTGTGAAACGAAAAACAGGTGTGTTCTAATGATAGGTAGTAGTA
AATAGTAGTCAGTACTAGTAATAACAATTTCAGTCGTGTCGATAGATTTCACGAGTCGCGTAAATTGGTTTTCGC
GCGATGTTATGATTGTGTCTTCTGGATTGCGCCTTTTCCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail