Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6648
Gene name
Locationscaffold_596:5559..10027
Strand+
Gene length (bp)4468
Transcript length (bp)4350
Coding sequence length (bp)4347
Protein length (aa) 1449

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08317 Spc7 Spc7 kinetochore protein 1.3E-79 969 1165
PF18210 Knl1_RWD_C Knl1 RWD C-terminal domain 1.0E-26 1195 1340
PF15402 MELT_2 MELT motif 5.5E-01 390 413
PF15402 MELT_2 MELT motif 1.6E-03 416 436
PF15402 MELT_2 MELT motif 1.7E-04 448 468
PF15402 MELT_2 MELT motif 1.5E-03 476 495
PF15402 MELT_2 MELT motif 4.3E-02 539 556

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O59757|SPC7_SCHPO Kinetochore protein spc7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spc7 PE=1 SV=1 973 1407 1.0E-34
sp|P53148|SP105_YEAST Spindle pole body component SPC105 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPC105 PE=1 SV=1 975 1280 2.0E-13

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6648
MFPTTDSASLATRRGRKSMGANTDVRNTMDRENATLNLGSSRAASRKSRSKSMGPGGLEALKQINGNRRASLAAP
LKLPRSILKPTLPPLPAIPSLKNGKKSSEKNGGGSQDSSRSLTLSSDEDHTGSKAAARAEEEQQADSKEREERER
RDARRKSLANRRVSFAAEATLHTFVDYMQEQDSTTSTDSTRRASSVAQRAPDRPTTLDGPEDVTKAHKESIAYSP
EKQRDSHQQRRRRRSSGFYPQNLNVTDENTVASTAYSSDSEPADAVEDIAEEEDEASSGDSDDGTMMTIDTEEVT
GTSVASDRSHATEDDSTLDEALRIAARRAGTQNLESAGNAEDDDDDDDDEEVIPSFGWVKRSIQPTDEGLDGQHA
EPSGVAEMDMEMDMEMDMDVDMDMDMTHAPGRILKPSSDCDSDLLGDVSMDVTQALGGILSFDKAPTAPEQAESE
EATMELTTAIGGIHRAQSEDADDVLGNEDMSMELTAVVGEVLPHSRNGRQTEVSRTNEAGFEDLAKDATSGVGQL
IALADAECNFKGEATMEMDMTAALGGIMESGETNLRIWNKRILEEEVNRPNDSAKAIVEAVARSPTRRASRASQE
AAQTPSESPGLSAFRGKGLRRSTDKRTSATPKRDSRSRTPSSVKTATPSPVKTAAPSPVKTATQSPVKTATPQRR
PASTPRKQTETTTPRTPSASPTRRILETQAKTPSPAKSTRQGASIFRNDPQTGDRTPNVVLTPPDRALSGMGIDR
PGLGSPKVAALCNRRCSIGDSASEFVLGKRTVAFEEPKKTEEDVERMRQEEEDKEDRVRILEREADGSQENRDAT
FNLREMINSLSPKWKPLRGRKSLHVGSAKGLLGKRPSELDEDEDGEDGDGVKRLKGHQSSPVKNVLLEKPTVGRL
TRSGRRSLEQARLTSTPSLSSPLKTTTTTTTTPRSQERFKDVEDNQTVRQINLHGSQVKDDVELARQVEEDKIHL
QDFLNMISIRFMELNTTKRRHTMAPGSGADGSTAQGQDALSLERCVVAGACTVPMLELYQHSCRELKKYISEGRR
MVKEIEDETLKENPPLFREYMSAGPDVKALMDHQFKNVKTHARLLSKAMWYEWRMKLQEGLKEGLVGVAEGMKTD
DRVFKEQQDMVASVLPGLVSHYESLREESKKLQEAARELADCDPAELASAREELMSLDADVATKKQQIAQLRKQL
EDSSTEVHELGSRKAECVQAIEACERTKERYRGWTGREVKALKARVEAMEKKHGWAISGLSGSNLSMTFRREIEL
LIDVGSLRAVDVRFAPESWEHQPGTDRQFMLRCICEHVRTLPEMRGQLSELLRVVGKGWDKARSVGRQISRINMV
FPTTVAKTADSSISVTSKLLLVPLKTLIEIQLKLDGCGGPGGVDVAVSVEARVMYGEQFNVGKLREFLAARIGPR
LGEGEDWSDAFLELRRKLLAKGSK
Coding >Ophio5|6648
ATGTTTCCAACTACTGATAGCGCTTCACTTGCGACGCGTCGCGGTCGCAAGTCTATGGGCGCAAACACGGACGTG
CGAAACACAATGGATCGGGAGAACGCGACGCTCAACTTGGGCAGCTCTCGAGCTGCTAGTCGCAAGTCCAGGAGC
AAGAGCATGGGCCCCGGCGGGCTGGAAGCTCTGAAGCAGATAAACGGGAATAGACGCGCGTCTCTTGCGGCCCCC
TTGAAGCTTCCGCGATCGATCCTAAAACCTACCTTACCCCCTCTTCCCGCGATTCCCTCGTTGAAGAATGGGAAG
AAAAGTTCAGAAAAGAATGGAGGAGGAAGTCAAGATTCGTCTCGCAGCCTCACCTTGTCCAGTGACGAAGATCAC
ACGGGATCCAAGGCCGCCGCCCGGGCCGAGGAGGAACAGCAAGCAGATTCCAAGGAGAGAGAAGAGCGCGAGAGG
CGCGATGCGCGCCGCAAGTCGCTCGCGAATCGGAGAGTCTCCTTTGCGGCCGAGGCGACGCTCCATACCTTCGTC
GACTACATGCAGGAGCAGGACTCTACGACGTCCACGGACTCGACCCGAAGAGCTTCGTCCGTTGCGCAGAGAGCC
CCCGACAGGCCTACCACCTTGGATGGCCCGGAAGATGTTACAAAAGCGCATAAGGAAAGCATAGCATACTCCCCG
GAAAAGCAGAGAGATTCACATCAGCAGCGTAGGCGGCGCCGGAGCTCCGGATTCTACCCTCAGAACCTGAACGTC
ACAGATGAAAACACAGTGGCCTCGACAGCTTACAGTTCCGACTCCGAGCCTGCCGATGCCGTGGAGGACATAGCC
GAAGAAGAAGATGAGGCGTCGAGCGGCGACTCAGACGACGGAACCATGATGACCATTGACACGGAGGAGGTGACC
GGAACCTCGGTCGCCTCGGACCGATCACACGCTACTGAAGACGACTCAACTCTGGACGAGGCGCTTAGAATTGCG
GCACGCAGGGCGGGGACGCAGAATCTTGAGAGTGCCGGCAACGCTGAGGACGACGACGACGACGACGACGACGAG
GAAGTTATCCCATCGTTTGGATGGGTGAAGAGGAGCATCCAGCCAACTGATGAGGGACTGGATGGCCAACATGCC
GAACCTAGTGGCGTTGCTGAAATGGACATGGAGATGGACATGGAGATGGATATGGATGTGGACATGGATATGGAC
ATGACGCATGCCCCTGGACGGATCTTGAAGCCTTCCAGCGACTGCGACTCAGATCTCCTTGGCGACGTGTCGATG
GATGTTACTCAAGCTCTCGGAGGCATTCTGTCATTCGACAAGGCGCCAACTGCACCCGAACAAGCCGAGTCAGAG
GAGGCCACCATGGAGCTGACGACGGCGATCGGCGGGATACACCGTGCCCAGAGCGAAGACGCGGATGACGTCCTG
GGCAACGAGGACATGTCGATGGAGCTGACAGCCGTTGTTGGCGAAGTCCTCCCTCATTCTAGAAACGGCCGACAG
ACAGAAGTGTCTCGAACAAATGAGGCAGGCTTTGAGGATCTAGCAAAAGATGCGACTTCTGGCGTCGGGCAGTTG
ATCGCTTTGGCCGACGCCGAATGCAATTTCAAAGGAGAGGCGACAATGGAAATGGACATGACGGCTGCCTTGGGA
GGCATCATGGAGAGCGGAGAGACAAACCTGCGGATCTGGAACAAGCGCATCCTGGAAGAAGAGGTCAATAGGCCT
AACGACTCGGCGAAAGCTATTGTTGAGGCTGTCGCTCGTTCGCCGACGCGAAGAGCTTCTCGAGCATCCCAGGAG
GCCGCACAGACGCCATCTGAGAGCCCTGGATTGTCAGCCTTCCGAGGGAAAGGCTTGCGCCGCAGCACGGACAAG
CGGACATCAGCCACGCCGAAACGTGATAGTCGATCGCGGACTCCATCTTCGGTCAAGACGGCGACTCCATCTCCG
GTCAAGACGGCTGCTCCATCTCCGGTCAAGACGGCGACGCAGTCTCCCGTCAAGACAGCGACGCCGCAGCGACGA
CCGGCTTCCACTCCCCGGAAGCAGACTGAGACGACAACTCCAAGAACGCCATCAGCTTCCCCTACGAGACGCATC
CTCGAGACGCAGGCAAAGACGCCGTCACCTGCCAAGTCAACTCGACAAGGGGCTTCCATCTTCCGCAATGACCCG
CAGACGGGCGACAGAACGCCGAATGTCGTCTTGACGCCTCCCGACCGAGCCCTCTCCGGCATGGGAATCGATCGG
CCCGGCCTGGGGTCTCCCAAAGTCGCGGCACTATGCAATCGCCGCTGCTCCATTGGCGATTCGGCGTCCGAGTTT
GTCCTAGGAAAGCGAACGGTAGCCTTTGAAGAGCCCAAGAAGACTGAGGAGGATGTCGAGAGGATGCGTCAAGAG
GAAGAGGATAAAGAAGACCGAGTCAGGATCCTCGAGCGCGAAGCAGACGGGTCACAGGAAAACAGGGACGCGACG
TTTAATCTTCGTGAGATGATCAACAGCCTCAGCCCGAAATGGAAGCCACTGAGAGGTCGCAAGAGTCTCCATGTC
GGCAGCGCCAAGGGCCTTCTGGGCAAGCGACCCTCTGAGCTGGATGAGGACGAGGATGGCGAAGATGGCGACGGG
GTGAAGAGGCTTAAGGGACACCAGAGTAGCCCCGTCAAAAACGTCTTACTCGAAAAGCCGACTGTCGGCCGTCTG
ACGAGATCGGGGCGAAGGAGCCTCGAGCAGGCCAGGTTGACGTCGACACCCTCGCTTTCCTCGCCGCTCAAGACG
ACGACGACGACGACGACGACGCCTCGGAGCCAGGAACGGTTCAAGGACGTTGAGGACAACCAGACGGTACGCCAG
ATCAACTTGCATGGTTCCCAAGTCAAGGATGACGTCGAGCTTGCGCGACAAGTCGAAGAGGACAAGATTCATCTA
CAGGACTTTCTCAACATGATCTCAATCCGCTTCATGGAGCTGAACACGACCAAGCGTCGTCACACCATGGCCCCG
GGAAGCGGCGCCGACGGCAGCACAGCCCAAGGGCAGGACGCGCTGTCTCTGGAGCGCTGCGTGGTGGCGGGTGCT
TGCACGGTGCCCATGCTCGAGCTCTATCAGCATTCGTGCCGGGAGCTGAAGAAGTACATTTCCGAAGGACGACGG
ATGGTCAAGGAGATTGAGGACGAGACGCTCAAGGAGAACCCGCCGCTGTTTCGCGAGTACATGTCGGCCGGTCCC
GATGTCAAGGCGCTGATGGATCACCAATTCAAGAATGTCAAGACACACGCCAGGCTCCTCAGCAAAGCCATGTGG
TACGAGTGGCGAATGAAGCTGCAGGAGGGCCTCAAGGAAGGGCTCGTCGGTGTCGCCGAGGGGATGAAAACGGAC
GACAGAGTTTTCAAGGAGCAGCAAGACATGGTGGCTTCTGTCCTGCCCGGCCTGGTATCGCATTACGAGTCTCTA
CGAGAGGAGAGCAAGAAGCTGCAGGAAGCTGCTCGGGAACTGGCCGATTGCGATCCGGCTGAGCTCGCATCAGCG
CGAGAGGAACTGATGAGCCTAGACGCAGACGTGGCTACCAAGAAGCAACAGATTGCCCAGCTTCGAAAACAACTG
GAAGACTCGTCTACGGAGGTGCACGAGCTGGGATCGAGAAAGGCCGAGTGCGTGCAAGCCATCGAGGCTTGCGAG
AGAACGAAAGAAAGGTACCGTGGCTGGACGGGCAGGGAGGTCAAGGCGTTGAAAGCACGGGTTGAAGCCATGGAG
AAAAAACATGGCTGGGCGATCTCGGGCTTGTCTGGAAGCAATCTGTCGATGACTTTTCGGCGAGAGATTGAGCTG
TTGATTGACGTCGGCTCGTTGCGGGCTGTCGACGTGCGGTTCGCTCCCGAGAGCTGGGAGCACCAACCCGGCACG
GACAGGCAGTTCATGCTTCGTTGCATCTGCGAACACGTCCGGACGCTGCCGGAGATGAGAGGCCAGCTGTCTGAG
CTGCTACGGGTGGTGGGAAAGGGTTGGGATAAGGCACGGTCGGTTGGGCGACAGATCAGCCGCATCAACATGGTG
TTTCCCACCACGGTGGCCAAGACGGCAGATTCGAGCATCTCGGTTACGAGCAAGCTACTACTGGTGCCTCTGAAG
ACGCTGATTGAAATCCAGCTCAAGCTGGACGGCTGTGGCGGGCCCGGAGGGGTCGACGTGGCCGTCTCAGTCGAG
GCTCGGGTCATGTACGGCGAGCAGTTCAACGTGGGCAAGTTGAGGGAATTCTTGGCAGCGAGGATTGGGCCGAGG
CTGGGGGAGGGCGAGGACTGGAGCGATGCGTTCTTGGAGCTGAGGCGAAAGCTCCTTGCCAAGGGGAGCAAG
Transcript >Ophio5|6648
ATGTTTCCAACTACTGATAGCGCTTCACTTGCGACGCGTCGCGGTCGCAAGTCTATGGGCGCAAACACGGACGTG
CGAAACACAATGGATCGGGAGAACGCGACGCTCAACTTGGGCAGCTCTCGAGCTGCTAGTCGCAAGTCCAGGAGC
AAGAGCATGGGCCCCGGCGGGCTGGAAGCTCTGAAGCAGATAAACGGGAATAGACGCGCGTCTCTTGCGGCCCCC
TTGAAGCTTCCGCGATCGATCCTAAAACCTACCTTACCCCCTCTTCCCGCGATTCCCTCGTTGAAGAATGGGAAG
AAAAGTTCAGAAAAGAATGGAGGAGGAAGTCAAGATTCGTCTCGCAGCCTCACCTTGTCCAGTGACGAAGATCAC
ACGGGATCCAAGGCCGCCGCCCGGGCCGAGGAGGAACAGCAAGCAGATTCCAAGGAGAGAGAAGAGCGCGAGAGG
CGCGATGCGCGCCGCAAGTCGCTCGCGAATCGGAGAGTCTCCTTTGCGGCCGAGGCGACGCTCCATACCTTCGTC
GACTACATGCAGGAGCAGGACTCTACGACGTCCACGGACTCGACCCGAAGAGCTTCGTCCGTTGCGCAGAGAGCC
CCCGACAGGCCTACCACCTTGGATGGCCCGGAAGATGTTACAAAAGCGCATAAGGAAAGCATAGCATACTCCCCG
GAAAAGCAGAGAGATTCACATCAGCAGCGTAGGCGGCGCCGGAGCTCCGGATTCTACCCTCAGAACCTGAACGTC
ACAGATGAAAACACAGTGGCCTCGACAGCTTACAGTTCCGACTCCGAGCCTGCCGATGCCGTGGAGGACATAGCC
GAAGAAGAAGATGAGGCGTCGAGCGGCGACTCAGACGACGGAACCATGATGACCATTGACACGGAGGAGGTGACC
GGAACCTCGGTCGCCTCGGACCGATCACACGCTACTGAAGACGACTCAACTCTGGACGAGGCGCTTAGAATTGCG
GCACGCAGGGCGGGGACGCAGAATCTTGAGAGTGCCGGCAACGCTGAGGACGACGACGACGACGACGACGACGAG
GAAGTTATCCCATCGTTTGGATGGGTGAAGAGGAGCATCCAGCCAACTGATGAGGGACTGGATGGCCAACATGCC
GAACCTAGTGGCGTTGCTGAAATGGACATGGAGATGGACATGGAGATGGATATGGATGTGGACATGGATATGGAC
ATGACGCATGCCCCTGGACGGATCTTGAAGCCTTCCAGCGACTGCGACTCAGATCTCCTTGGCGACGTGTCGATG
GATGTTACTCAAGCTCTCGGAGGCATTCTGTCATTCGACAAGGCGCCAACTGCACCCGAACAAGCCGAGTCAGAG
GAGGCCACCATGGAGCTGACGACGGCGATCGGCGGGATACACCGTGCCCAGAGCGAAGACGCGGATGACGTCCTG
GGCAACGAGGACATGTCGATGGAGCTGACAGCCGTTGTTGGCGAAGTCCTCCCTCATTCTAGAAACGGCCGACAG
ACAGAAGTGTCTCGAACAAATGAGGCAGGCTTTGAGGATCTAGCAAAAGATGCGACTTCTGGCGTCGGGCAGTTG
ATCGCTTTGGCCGACGCCGAATGCAATTTCAAAGGAGAGGCGACAATGGAAATGGACATGACGGCTGCCTTGGGA
GGCATCATGGAGAGCGGAGAGACAAACCTGCGGATCTGGAACAAGCGCATCCTGGAAGAAGAGGTCAATAGGCCT
AACGACTCGGCGAAAGCTATTGTTGAGGCTGTCGCTCGTTCGCCGACGCGAAGAGCTTCTCGAGCATCCCAGGAG
GCCGCACAGACGCCATCTGAGAGCCCTGGATTGTCAGCCTTCCGAGGGAAAGGCTTGCGCCGCAGCACGGACAAG
CGGACATCAGCCACGCCGAAACGTGATAGTCGATCGCGGACTCCATCTTCGGTCAAGACGGCGACTCCATCTCCG
GTCAAGACGGCTGCTCCATCTCCGGTCAAGACGGCGACGCAGTCTCCCGTCAAGACAGCGACGCCGCAGCGACGA
CCGGCTTCCACTCCCCGGAAGCAGACTGAGACGACAACTCCAAGAACGCCATCAGCTTCCCCTACGAGACGCATC
CTCGAGACGCAGGCAAAGACGCCGTCACCTGCCAAGTCAACTCGACAAGGGGCTTCCATCTTCCGCAATGACCCG
CAGACGGGCGACAGAACGCCGAATGTCGTCTTGACGCCTCCCGACCGAGCCCTCTCCGGCATGGGAATCGATCGG
CCCGGCCTGGGGTCTCCCAAAGTCGCGGCACTATGCAATCGCCGCTGCTCCATTGGCGATTCGGCGTCCGAGTTT
GTCCTAGGAAAGCGAACGGTAGCCTTTGAAGAGCCCAAGAAGACTGAGGAGGATGTCGAGAGGATGCGTCAAGAG
GAAGAGGATAAAGAAGACCGAGTCAGGATCCTCGAGCGCGAAGCAGACGGGTCACAGGAAAACAGGGACGCGACG
TTTAATCTTCGTGAGATGATCAACAGCCTCAGCCCGAAATGGAAGCCACTGAGAGGTCGCAAGAGTCTCCATGTC
GGCAGCGCCAAGGGCCTTCTGGGCAAGCGACCCTCTGAGCTGGATGAGGACGAGGATGGCGAAGATGGCGACGGG
GTGAAGAGGCTTAAGGGACACCAGAGTAGCCCCGTCAAAAACGTCTTACTCGAAAAGCCGACTGTCGGCCGTCTG
ACGAGATCGGGGCGAAGGAGCCTCGAGCAGGCCAGGTTGACGTCGACACCCTCGCTTTCCTCGCCGCTCAAGACG
ACGACGACGACGACGACGACGCCTCGGAGCCAGGAACGGTTCAAGGACGTTGAGGACAACCAGACGGTACGCCAG
ATCAACTTGCATGGTTCCCAAGTCAAGGATGACGTCGAGCTTGCGCGACAAGTCGAAGAGGACAAGATTCATCTA
CAGGACTTTCTCAACATGATCTCAATCCGCTTCATGGAGCTGAACACGACCAAGCGTCGTCACACCATGGCCCCG
GGAAGCGGCGCCGACGGCAGCACAGCCCAAGGGCAGGACGCGCTGTCTCTGGAGCGCTGCGTGGTGGCGGGTGCT
TGCACGGTGCCCATGCTCGAGCTCTATCAGCATTCGTGCCGGGAGCTGAAGAAGTACATTTCCGAAGGACGACGG
ATGGTCAAGGAGATTGAGGACGAGACGCTCAAGGAGAACCCGCCGCTGTTTCGCGAGTACATGTCGGCCGGTCCC
GATGTCAAGGCGCTGATGGATCACCAATTCAAGAATGTCAAGACACACGCCAGGCTCCTCAGCAAAGCCATGTGG
TACGAGTGGCGAATGAAGCTGCAGGAGGGCCTCAAGGAAGGGCTCGTCGGTGTCGCCGAGGGGATGAAAACGGAC
GACAGAGTTTTCAAGGAGCAGCAAGACATGGTGGCTTCTGTCCTGCCCGGCCTGGTATCGCATTACGAGTCTCTA
CGAGAGGAGAGCAAGAAGCTGCAGGAAGCTGCTCGGGAACTGGCCGATTGCGATCCGGCTGAGCTCGCATCAGCG
CGAGAGGAACTGATGAGCCTAGACGCAGACGTGGCTACCAAGAAGCAACAGATTGCCCAGCTTCGAAAACAACTG
GAAGACTCGTCTACGGAGGTGCACGAGCTGGGATCGAGAAAGGCCGAGTGCGTGCAAGCCATCGAGGCTTGCGAG
AGAACGAAAGAAAGGTACCGTGGCTGGACGGGCAGGGAGGTCAAGGCGTTGAAAGCACGGGTTGAAGCCATGGAG
AAAAAACATGGCTGGGCGATCTCGGGCTTGTCTGGAAGCAATCTGTCGATGACTTTTCGGCGAGAGATTGAGCTG
TTGATTGACGTCGGCTCGTTGCGGGCTGTCGACGTGCGGTTCGCTCCCGAGAGCTGGGAGCACCAACCCGGCACG
GACAGGCAGTTCATGCTTCGTTGCATCTGCGAACACGTCCGGACGCTGCCGGAGATGAGAGGCCAGCTGTCTGAG
CTGCTACGGGTGGTGGGAAAGGGTTGGGATAAGGCACGGTCGGTTGGGCGACAGATCAGCCGCATCAACATGGTG
TTTCCCACCACGGTGGCCAAGACGGCAGATTCGAGCATCTCGGTTACGAGCAAGCTACTACTGGTGCCTCTGAAG
ACGCTGATTGAAATCCAGCTCAAGCTGGACGGCTGTGGCGGGCCCGGAGGGGTCGACGTGGCCGTCTCAGTCGAG
GCTCGGGTCATGTACGGCGAGCAGTTCAACGTGGGCAAGTTGAGGGAATTCTTGGCAGCGAGGATTGGGCCGAGG
CTGGGGGAGGGCGAGGACTGGAGCGATGCGTTCTTGGAGCTGAGGCGAAAGCTCCTTGCCAAGGGGAGCAAGTGA
Gene >Ophio5|6648
ATGTTTCCAACTACTGATAGCGCTTCACTTGCGACGCGTCGCGGTCGCAAGTCTATGGGCGCAAACACGGACGTG
CGAAACACAATGGATCGGGAGAACGCGACGCTCAACTTGGGCAGCTCTCGAGCTGCTAGTCGCAAGTCCAGGAGC
AAGAGCATGGGCCCCGGCGGGCTGGAAGCTCTGAAGCAGATAAACGGGAATAGACGCGCGGTATGAATATCAGAT
CCGTAGCTTTGAATCGCCACTGATCGTGTTTACAGTCTCTTGCGGCCCCCTTGAAGCTTCCGCGATCGATCCTAA
AACCTACCTTACCCCCTCTTCCCGCGATTCCCTCGTTGAAGAATGGGAAGAAAAGTTCAGAAAAGAATGGAGGAG
GAAGTCAAGATTCGTCTCGCAGCCTCACCTTGTCCAGTGACGAAGATCACACGGGATCCAAGGCCGCCGCCCGGG
CCGAGGAGGAACAGCAAGCAGATTCCAAGGAGAGAGAAGAGCGCGAGAGGCGCGATGCGCGCCGCAAGTCGCTCG
CGAATCGGAGAGTCTCCTTTGCGGCCGAGGCGACGCTCCATACCTTCGTCGACTACATGCAGGAGCAGGACTCTA
CGACGTCCACGGACTCGACCCGAAGAGCTTCGTCCGTTGCGCAGAGAGCCCCCGACAGGCCTACCACCTTGGATG
GCCCGGAAGATGTTACAAAAGCGCATAAGGAAAGCATAGCATACTCCCCGGAAAAGCAGAGAGATTCACATCAGC
AGCGTAGGCGGCGCCGGAGCTCCGGATTCTACCCTCAGAACCTGAACGTCACAGATGAAAACACAGTGGCCTCGA
CAGCTTACAGTTCCGACTCCGAGCCTGCCGATGCCGTGGAGGACATAGCCGAAGAAGAAGATGAGGCGTCGAGCG
GCGACTCAGACGACGGAACCATGATGACCATTGACACGGAGGAGGTGACCGGAACCTCGGTCGCCTCGGACCGAT
CACACGCTACTGAAGACGACTCAACTCTGGACGAGGCGCTTAGAATTGCGGCACGCAGGGCGGGGACGCAGAATC
TTGAGAGTGCCGGCAACGCTGAGGACGACGACGACGACGACGACGACGAGGAAGTTATCCCATCGTTTGGATGGG
TGAAGAGGAGCATCCAGCCAACTGATGAGGGACTGGATGGCCAACATGCCGAACCTAGTGGCGTTGCTGAAATGG
ACATGGAGATGGACATGGAGATGGATATGGATGTGGACATGGATATGGACATGACGCATGCCCCTGGACGGATCT
TGAAGCCTTCCAGCGACTGCGACTCAGATCTCCTTGGCGACGTGTCGATGGATGTTACTCAAGCTCTCGGAGGCA
TTCTGTCATTCGACAAGGCGCCAACTGCACCCGAACAAGCCGAGTCAGAGGAGGCCACCATGGAGCTGACGACGG
CGATCGGCGGGATACACCGTGCCCAGAGCGAAGACGCGGATGACGTCCTGGGCAACGAGGACATGTCGATGGAGC
TGACAGCCGTTGTTGGCGAAGTCCTCCCTCATTCTAGAAACGGCCGACAGACAGAAGTGTCTCGAACAAATGAGG
CAGGCTTTGAGGATCTAGCAAAAGATGCGACTTCTGGCGTCGGGCAGTTGATCGCTTTGGCCGACGCCGAATGCA
ATTTCAAAGGAGAGGCGACAATGGAAATGGACATGACGGCTGCCTTGGGAGGCATCATGGAGAGCGGAGAGACAA
ACCTGCGGATCTGGAACAAGCGCATCCTGGAAGAAGAGGTCAATAGGCCTAACGACTCGGCGAAAGCTATTGTTG
AGGCTGTCGCTCGTTCGCCGACGCGAAGAGCTTCTCGAGCATCCCAGGAGGCCGCACAGACGCCATCTGAGAGCC
CTGGATTGTCAGCCTTCCGAGGGAAAGGCTTGCGCCGCAGCACGGACAAGCGGACATCAGCCACGCCGAAACGTG
ATAGTCGATCGCGGACTCCATCTTCGGTCAAGACGGCGACTCCATCTCCGGTCAAGACGGCTGCTCCATCTCCGG
TCAAGACGGCGACGCAGTCTCCCGTCAAGACAGCGACGCCGCAGCGACGACCGGCTTCCACTCCCCGGAAGCAGA
CTGAGACGACAACTCCAAGAACGCCATCAGCTTCCCCTACGAGACGCATCCTCGAGACGCAGGCAAAGACGCCGT
CACCTGCCAAGTCAACTCGACAAGGGGCTTCCATCTTCCGCAATGACCCGCAGACGGGCGACAGAACGCCGAATG
TCGTCTTGACGCCTCCCGACCGAGCCCTCTCCGGCATGGGAATCGATCGGCCCGGCCTGGGGTCTCCCAAAGTCG
CGGCACTATGCAATCGCCGCTGCTCCATTGGCGATTCGGCGTCCGAGTTTGTCCTAGGAAAGCGAACGGTAGCCT
TTGAAGAGCCCAAGAAGACTGAGGAGGATGTCGAGAGGATGCGTCAAGAGGAAGAGGATAAAGAAGACCGAGTCA
GGATCCTCGAGCGCGAAGCAGACGGGTCACAGGAAAACAGGGACGCGACGTTTAATCTTCGTGAGATGATCAACA
GCCTCAGCCCGAAATGGAAGCCACTGAGAGGTCGCAAGAGTCTCCATGTCGGCAGCGCCAAGGGCCTTCTGGGCA
AGCGACCCTCTGAGCTGGATGAGGACGAGGATGGCGAAGATGGCGACGGGGTGAAGAGGCTTAAGGGACACCAGA
GTAGCCCCGTCAAAAACGTCTTACTCGAAAAGCCGACTGTCGGCCGTCTGACGAGATCGGGGCGAAGGAGCCTCG
AGCAGGCCAGGTTGACGTCGACACCCTCGCTTTCCTCGCCGCTCAAGACGACGACGACGACGACGACGACGCCTC
GGAGCCAGGAACGGTTCAAGGACGTTGAGGACAACCAGACGGTACGCCAGATCAACTTGCATGGTTCCCAAGTCA
AGGATGACGTCGAGCTTGCGCGACAAGTCGAAGAGGACAAGATTCATCTACAGGACTTTCTCAACATGATCTCAA
TCCGCTTCATGGAGCTGAACACGACCAAGCGTCGTCACACCATGGCCCCGGGAAGCGGCGCCGACGGCAGCACAG
CCCAAGGGCAGGACGCGCTGTCTCTGGAGCGCTGCGTGGTGGCGGGTGCTTGCACGGTGCCCATGCTCGAGCTCT
ATCAGCATTCGTGCCGGGAGCTGAAGAAGTACATTTCCGAAGGACGACGGATGGTCAAGGAGATTGAGGACGAGA
CGCTCAAGGAGAACCCGCCGCTGTTTCGCGAGTACATGTCGGCCGGTCCCGATGTCAAGGCGCTGATGGATCACC
AATTCAAGAATGTCAAGACACACGCCAGGCTCCTCAGCAAAGCCATGTGGTACGAGTGGCGAATGAAGCTGCAGG
AGGGCCTCAAGGAAGGGCTCGTCGGTGTCGCCGAGGGGATGAAAACGGACGACAGAGTTTTCAAGGAGCAGCAAG
ACATGGTGGCTTCTGTCCTGCCCGGCCTGGTATCGCATTACGAGTCTCTACGAGAGGAGAGCAAGAAGCTGCAGG
AAGCTGCTCGGGAACTGGCCGATTGCGATCCGGCTGAGCTCGCATCAGCGCGAGAGGAACTGATGAGCCTAGACG
CAGACGTGGCTACCAAGAAGCAACAGATTGCCCAGCTTCGAAAACAACTGGAAGACTCGTCTACGGAGGTGCACG
AGCTGGGATCGAGAAAGGCCGAGTGCGTGCAAGCCATCGAGGCTTGCGAGAGAACGAAAGAAAGGTACCGTGGCT
GGACGGGCAGGGAGGTCAAGGCGTTGAAAGGTAAGGTCAAGCAGCTGGCTGCTGGGCTACAACTCTATATGACAG
ACTGGCGCTGACGGCGAAAGCAGCACGGGTTGAAGCCATGGAGAAAAAACATGGCTGGGCGATCTCGGGCTTGTC
TGGAAGCAATCTGTCGATGACTTTTCGGCGAGAGATTGAGCTGTTGATTGACGTCGGCTCGTTGCGGGCTGTCGA
CGTGCGGTTCGCTCCCGAGAGCTGGGAGCACCAACCCGGCACGGACAGGCAGTTCATGCTTCGTTGCATCTGCGA
ACACGTCCGGACGCTGCCGGAGATGAGAGGCCAGCTGTCTGAGCTGCTACGGGTGGTGGGAAAGGGTTGGGATAA
GGCACGGTCGGTTGGGCGACAGATCAGCCGCATCAACATGGTGTTTCCCACCACGGTGGCCAAGACGGCAGATTC
GAGCATCTCGGTTACGAGCAAGCTACTACTGGTGCCTCTGAAGACGCTGATTGAAATCCAGCTCAAGCTGGACGG
CTGTGGCGGGCCCGGAGGGGTCGACGTGGCCGTCTCAGTCGAGGCTCGGGTCATGTACGGCGAGCAGTTCAACGT
GGGCAAGTTGAGGGAATTCTTGGCAGCGAGGATTGGGCCGAGGCTGGGGGAGGGCGAGGACTGGAGCGATGCGTT
CTTGGAGCTGAGGCGAAAGCTCCTTGCCAAGGGGAGCAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail