Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6637
Gene name
Locationscaffold_593:11125..11518
Strand-
Gene length (bp)393
Transcript length (bp)393
Coding sequence length (bp)390
Protein length (aa) 130

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09435 DUF2015 Fungal protein of unknown function (DUF2015) 1.4E-44 12 125

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q876Z1|YCB2_ASHGO UPF0357 protein AAL017W OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AAL017W PE=3 SV=1 44 129 3.0E-18
sp|Q8J0M6|YCB2_SACBA UPF0357 protein YCL012C OS=Saccharomyces bayanus GN=YCL012C PE=3 SV=1 8 129 8.0E-17
sp|Q8J0N0|YCB2_SACPA UPF0357 protein YCL012C OS=Saccharomyces paradoxus GN=YCL012C PE=3 SV=1 46 129 2.0E-15
sp|O14068|YFF7_SCHPO UPF0357 protein C1687.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1687.07 PE=3 SV=1 1 128 4.0E-15
sp|Q8J0M4|YCB2_YEAST UPF0357 protein YCL012C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCL012C PE=1 SV=2 44 129 2.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 5 24 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6637
MAYKYIFFSFSVFLFIVATALFLTRDHWRRHVPAIRLPGAGYLYSQLPRSFVDDMDAGLSSDTFDLGGNVEAGDS
RAGLDGAGKAEILKIMKKRRMTFDQARKLYTENRFKANGIGADGRPRDPKFVSFS
Coding >Ophio5|6637
ATGGCCTACAAATACATCTTCTTCAGCTTCTCCGTCTTCCTCTTCATCGTCGCAACCGCCCTCTTCCTCACCCGC
GATCACTGGCGTCGCCATGTCCCCGCCATTCGTCTGCCCGGCGCAGGCTACCTCTACTCGCAGCTGCCGCGGAGC
TTCGTCGATGACATGGACGCCGGCCTGTCGAGCGATACCTTTGATCTGGGTGGCAACGTAGAGGCTGGCGATAGT
CGCGCCGGTCTCGACGGGGCGGGGAAAGCCGAGATTCTTAAGATCATGAAGAAGAGGCGCATGACCTTCGATCAG
GCTCGCAAGTTATATACGGAGAATCGGTTCAAGGCAAACGGTATCGGCGCCGACGGCCGGCCACGGGATCCCAAG
TTTGTCAGCTTCTCC
Transcript >Ophio5|6637
ATGGCCTACAAATACATCTTCTTCAGCTTCTCCGTCTTCCTCTTCATCGTCGCAACCGCCCTCTTCCTCACCCGC
GATCACTGGCGTCGCCATGTCCCCGCCATTCGTCTGCCCGGCGCAGGCTACCTCTACTCGCAGCTGCCGCGGAGC
TTCGTCGATGACATGGACGCCGGCCTGTCGAGCGATACCTTTGATCTGGGTGGCAACGTAGAGGCTGGCGATAGT
CGCGCCGGTCTCGACGGGGCGGGGAAAGCCGAGATTCTTAAGATCATGAAGAAGAGGCGCATGACCTTCGATCAG
GCTCGCAAGTTATATACGGAGAATCGGTTCAAGGCAAACGGTATCGGCGCCGACGGCCGGCCACGGGATCCCAAG
TTTGTCAGCTTCTCCTGA
Gene >Ophio5|6637
ATGGCCTACAAATACATCTTCTTCAGCTTCTCCGTCTTCCTCTTCATCGTCGCAACCGCCCTCTTCCTCACCCGC
GATCACTGGCGTCGCCATGTCCCCGCCATTCGTCTGCCCGGCGCAGGCTACCTCTACTCGCAGCTGCCGCGGAGC
TTCGTCGATGACATGGACGCCGGCCTGTCGAGCGATACCTTTGATCTGGGTGGCAACGTAGAGGCTGGCGATAGT
CGCGCCGGTCTCGACGGGGCGGGGAAAGCCGAGATTCTTAAGATCATGAAGAAGAGGCGCATGACCTTCGATCAG
GCTCGCAAGTTATATACGGAGAATCGGTTCAAGGCAAACGGTATCGGCGCCGACGGCCGGCCACGGGATCCCAAG
TTTGTCAGCTTCTCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail