Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6621
Gene name
Locationscaffold_59:48339..49690
Strand+
Gene length (bp)1351
Transcript length (bp)1149
Coding sequence length (bp)1146
Protein length (aa) 382

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 6.2E-18 10 82
PF04116 FA_hydroxylase Fatty acid hydroxylase 1.1E-11 226 368

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03529|SCS7_YEAST Ceramide very long chain fatty acid hydroxylase SCS7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCS7 PE=1 SV=1 3 372 1.0E-131
sp|O13846|SCS7_SCHPO Ceramide very long chain fatty acid hydroxylase-like protein C19G12.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19G12.08 PE=3 SV=1 19 369 8.0E-101
sp|Q9SUC5|FAH2_ARATH Fatty acid 2-hydroxylase 2 OS=Arabidopsis thaliana GN=FAH2 PE=1 SV=1 142 380 5.0E-49
sp|Q5MPP0|FA2H_MOUSE Fatty acid 2-hydroxylase OS=Mus musculus GN=Fa2h PE=1 SV=1 8 368 2.0E-47
sp|Q2LAM0|FA2H_RAT Fatty acid 2-hydroxylase OS=Rattus norvegicus GN=Fa2h PE=1 SV=2 8 368 6.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03529|SCS7_YEAST Ceramide very long chain fatty acid hydroxylase SCS7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCS7 PE=1 SV=1 3 372 1.0E-131
sp|O13846|SCS7_SCHPO Ceramide very long chain fatty acid hydroxylase-like protein C19G12.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19G12.08 PE=3 SV=1 19 369 8.0E-101
sp|Q9SUC5|FAH2_ARATH Fatty acid 2-hydroxylase 2 OS=Arabidopsis thaliana GN=FAH2 PE=1 SV=1 142 380 5.0E-49
sp|Q5MPP0|FA2H_MOUSE Fatty acid 2-hydroxylase OS=Mus musculus GN=Fa2h PE=1 SV=1 8 368 2.0E-47
sp|Q2LAM0|FA2H_RAT Fatty acid 2-hydroxylase OS=Rattus norvegicus GN=Fa2h PE=1 SV=2 8 368 6.0E-47
sp|O48916|FAH1_ARATH Fatty acid 2-hydroxylase 1 OS=Arabidopsis thaliana GN=FAH1 PE=1 SV=1 142 368 3.0E-46
sp|Q4R4P4|FA2H_MACFA Fatty acid 2-hydroxylase OS=Macaca fascicularis GN=FA2H PE=2 SV=1 13 368 6.0E-46
sp|Q7L5A8|FA2H_HUMAN Fatty acid 2-hydroxylase OS=Homo sapiens GN=FA2H PE=1 SV=1 13 368 1.0E-44
sp|Q9ZWT2|CYB5D_ARATH Cytochrome B5 isoform D OS=Arabidopsis thaliana GN=CYTB5-D PE=1 SV=1 10 106 5.0E-12
sp|Q9V4N3|CYB5_DROME Cytochrome b5 OS=Drosophila melanogaster GN=Cyt-b5 PE=2 SV=1 1 92 3.0E-11
sp|O04354|CYB5_BOROF Cytochrome b5 OS=Borago officinalis PE=2 SV=1 10 94 7.0E-11
sp|P49099|CYB5S_TOBAC Cytochrome b5, seed isoform OS=Nicotiana tabacum PE=2 SV=1 10 94 9.0E-11
sp|P49098|CYB5_TOBAC Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1 10 86 1.0E-10
sp|O48845|CYB5B_ARATH Cytochrome b5 isoform B OS=Arabidopsis thaliana GN=CYTB5-B PE=1 SV=1 10 94 2.0E-10
sp|Q9USM6|CYB52_SCHPO Probable cytochrome b5 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oca8 PE=3 SV=1 8 111 2.0E-10
sp|O94391|CYB51_SCHPO Probable cytochrome b5 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.16c PE=3 SV=1 13 82 3.0E-10
sp|P49097|CYB5_CUSRE Cytochrome b5 OS=Cuscuta reflexa PE=2 SV=1 12 86 3.0E-10
sp|Q42342|CYB5E_ARATH Cytochrome b5 isoform E OS=Arabidopsis thaliana GN=CYTB5-E PE=1 SV=2 3 101 5.0E-10
sp|P49096|CYB5_MUSDO Cytochrome b5 OS=Musca domestica GN=Cyt-b5 PE=1 SV=1 1 91 2.0E-09
sp|P40934|CYB5_BRAOB Cytochrome b5 OS=Brassica oleracea var. botrytis GN=CYB5 PE=1 SV=1 13 86 5.0E-09
sp|P49100|CYB5_ORYSJ Cytochrome b5 OS=Oryza sativa subsp. japonica GN=Os05g0108800 PE=2 SV=2 1 84 7.0E-09
sp|Q9FDW8|CYB5A_ARATH Cytochrome b5 isoform A OS=Arabidopsis thaliana GN=CB5-A PE=1 SV=1 6 82 2.0E-08
sp|Q8X0J4|CYB5L_NEUCR Putative cytochrome b5 B11H24.095 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B11H24.095 PE=3 SV=1 8 55 4.0E-08
sp|P36841|NIA_VOLCA Nitrate reductase [NADH] OS=Volvox carteri GN=NITA PE=2 SV=1 10 117 4.0E-08
sp|P39868|NIA2_BRANA Nitrate reductase [NADH], clone PBNBR1412 OS=Brassica napus GN=NIA2 PE=2 SV=1 12 141 4.0E-08
sp|Q9P5L0|CYB5_NEUCR Probable cytochrome b5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B23L21.190 PE=3 SV=2 10 82 6.0E-08
sp|Q9HFV1|CYB5_RHIST Cytochrome b5 OS=Rhizopus stolonifer PE=2 SV=1 13 82 6.0E-08
sp|Q9Y706|CYB5_MORAP Cytochrome b5 OS=Mortierella alpina PE=1 SV=1 6 116 1.0E-07
sp|P11832|NIA1_ARATH Nitrate reductase [NADH] 1 OS=Arabidopsis thaliana GN=NIA1 PE=1 SV=3 12 141 1.0E-07
sp|P39867|NIA1_BRANA Nitrate reductase [NADH], clone PBNBR1405 OS=Brassica napus GN=NIA1 PE=2 SV=1 12 141 3.0E-07
sp|P82291|CYB5_ECTSH Soluble cytochrome b558 OS=Ectothiorhodospira shaposhnikovii PE=1 SV=2 5 82 3.0E-07
sp|Q874I5|CYB5_CANTR Cytochrome b5 OS=Candida tropicalis GN=Cytb5 PE=3 SV=1 10 92 4.0E-07
sp|Q10352|YDAA_SCHPO Uncharacterized protein C1F12.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F12.10c PE=3 SV=1 9 84 5.0E-07
sp|Q9Y1W0|FAD5A_DICDI Delta(5) fatty acid desaturase A OS=Dictyostelium discoideum GN=fadA PE=1 SV=1 12 86 5.0E-07
sp|P32953|CYBL_RHOGR (S)-mandelate dehydrogenase, mitochondrial OS=Rhodotorula graminis PE=1 SV=2 8 84 5.0E-07
sp|P00172|CYB5_PIG Cytochrome b5 OS=Sus scrofa GN=CYB5A PE=1 SV=3 10 99 7.0E-07
sp|P49102|NIA3_MAIZE Nitrate reductase [NADH] 3 OS=Zea mays PE=3 SV=1 3 141 9.0E-07
sp|P00170|CYB5_HORSE Cytochrome b5 OS=Equus caballus GN=CYB5A PE=1 SV=3 10 97 9.0E-07
sp|P36859|NIA_PETHY Nitrate reductase [NADH] OS=Petunia hybrida GN=NIA PE=2 SV=1 12 141 1.0E-06
sp|P00171|CYB5_BOVIN Cytochrome b5 OS=Bos taurus GN=CYB5A PE=1 SV=3 3 82 1.0E-06
sp|P11035|NIA2_ARATH Nitrate reductase [NADH] 2 OS=Arabidopsis thaliana GN=NIA2 PE=1 SV=1 5 82 1.0E-06
sp|Q9CQX2|CYB5B_MOUSE Cytochrome b5 type B OS=Mus musculus GN=Cyb5b PE=1 SV=1 13 84 1.0E-06
sp|P00173|CYB5_RAT Cytochrome b5 OS=Rattus norvegicus GN=Cyb5a PE=1 SV=2 10 99 1.0E-06
sp|P27783|NIA_BETPN Nitrate reductase [NAD(P)H] OS=Betula pendula GN=NIA1 PE=2 SV=1 12 116 1.0E-06
sp|O22704|CYP5F_ARATH Cytochrome B5-like protein OS=Arabidopsis thaliana GN=CB5LP PE=2 SV=1 8 82 2.0E-06
sp|P39870|NIA2_SOYBN Inducible nitrate reductase [NADH] 2 OS=Glycine max GN=INR2 PE=2 SV=1 5 141 2.0E-06
sp|P56395|CYB5_MOUSE Cytochrome b5 OS=Mus musculus GN=Cyb5a PE=1 SV=2 10 97 2.0E-06
sp|P04166|CYB5B_RAT Cytochrome b5 type B OS=Rattus norvegicus GN=Cyb5b PE=1 SV=2 13 84 2.0E-06
sp|Q01170|NIA_CHLVU Nitrate reductase [NADH] (Fragment) OS=Chlorella vulgaris PE=2 SV=1 8 106 3.0E-06
sp|Q5UR80|CYB5L_MIMIV Cytochrome b5-like protein OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L628 PE=3 SV=1 13 76 3.0E-06
sp|P00174|CYB5_CHICK Cytochrome b5 OS=Gallus gallus GN=CYB5A PE=1 SV=4 13 62 3.0E-06
sp|Q5RDJ5|CYB5B_PONAB Cytochrome b5 type B OS=Pongo abelii GN=CYB5B PE=2 SV=2 13 84 3.0E-06
sp|P39869|NIA_LOTJA Nitrate reductase [NADH] OS=Lotus japonicus GN=NIA PE=3 SV=1 12 82 4.0E-06
sp|O43169|CYB5B_HUMAN Cytochrome b5 type B OS=Homo sapiens GN=CYB5B PE=1 SV=2 13 84 4.0E-06
sp|P00167|CYB5_HUMAN Cytochrome b5 OS=Homo sapiens GN=CYB5A PE=1 SV=2 10 82 5.0E-06
sp|P17569|NIA_CUCMA Nitrate reductase [NADH] OS=Cucurbita maxima PE=2 SV=1 8 82 5.0E-06
sp|P54233|NIA1_SOYBN Inducible nitrate reductase [NADH] 1 OS=Glycine max GN=INR1 PE=2 SV=1 5 82 5.0E-06
sp|P23312|NIA_SPIOL Nitrate reductase [NADH] OS=Spinacia oleracea GN=NIA PE=2 SV=1 12 141 5.0E-06
sp|Q9ZNV4|CYB5C_ARATH Cytochrome B5 isoform C OS=Arabidopsis thaliana GN=CYTB5-C PE=1 SV=1 13 84 5.0E-06
sp|P43101|NIA_CICIN Nitrate reductase [NADH] OS=Cichorium intybus GN=NIA PE=2 SV=1 8 82 6.0E-06
sp|P00175|CYB2_YEAST Cytochrome b2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB2 PE=1 SV=1 9 61 7.0E-06
sp|P00168|CYB5_ALOSE Cytochrome b5 (Fragment) OS=Alouatta seniculus GN=CYB5A PE=1 SV=2 10 82 7.0E-06
sp|P09437|CYB2_WICAO Cytochrome b2, mitochondrial OS=Wickerhamomyces anomalus GN=CYB2 PE=1 SV=2 9 59 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0008610 lipid biosynthetic process Yes
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0009058 biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0046872 metal ion binding No
GO:0046914 transition metal ion binding No
GO:0044238 primary metabolic process No
GO:0006629 lipid metabolic process No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:1901576 organic substance biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 191 210 19
2 217 239 22
3 277 299 22
4 306 328 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 153.49 81.86 225.11
CcL In ants, during behavior modification 87.11 46.84 127.38
CcD In ants, recently dead 73.75 39.99 107.52

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.010753 yes
SC16a CcD 0.000770 yes
CcL CcD 0.503777 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6621
MPSRTLPTLTRAEVQSHDSTASCYVTIGSKVYDVTDFLSDHPGGAHLILEYAGKDVEAILQDPASHPHSEAAYEV
LDDSLVGFVASPKAVVATPVTTGAVAAPGKSGSDPVPQVHPRTGMSCEGDLSKETDYSQDYKKHKFLDLSKPLFP
QVWYGGFSKEFYLDQVHRPRHYKGGKSAPLFGNFLEPLTKTPWWLIPTLWLPCVAYGTYLASQGYYGPLATASFW
AFGLFLWTLIEYGMHRFLFHVDDYLPDNRVGITAHFLLHGVHHYLPMDKYRLVMPPTLFVVLATPFWRLAHVLLS
FDWHAATAVFCGGIFGYICYDLTHYFLHHQNLPLWYKQLKKYHLQHHFLDYELGFGVTSKFWDTVFGTELQPIKT
SATNSIF
Coding >Ophio5|6621
ATGCCTTCGAGGACGCTGCCGACGCTGACTCGCGCCGAGGTGCAATCGCACGACTCTACTGCCTCGTGCTACGTC
ACCATTGGCTCCAAGGTCTACGATGTCACCGACTTCCTTTCCGACCACCCCGGCGGCGCCCATCTCATCCTAGAA
TACGCCGGCAAGGATGTCGAGGCTATTCTTCAGGATCCCGCCTCGCACCCCCACTCCGAGGCCGCCTACGAGGTC
CTCGACGACTCCTTGGTCGGCTTTGTCGCCTCGCCAAAGGCCGTCGTGGCCACTCCTGTCACCACTGGCGCCGTC
GCGGCTCCCGGCAAGTCCGGCTCCGACCCCGTCCCCCAGGTCCACCCCCGCACCGGCATGTCGTGCGAGGGCGAC
TTGTCCAAGGAGACCGATTACAGCCAGGACTACAAGAAGCACAAGTTTCTGGACCTTAGCAAGCCGCTCTTCCCT
CAGGTCTGGTACGGCGGCTTCAGCAAAGAATTCTATCTCGACCAGGTCCACCGCCCGCGCCACTACAAGGGCGGC
AAGTCGGCGCCTTTGTTTGGCAACTTCCTTGAGCCGCTCACCAAGACGCCGTGGTGGCTTATTCCTACTCTTTGG
CTGCCCTGTGTCGCATACGGCACCTATCTCGCCTCCCAAGGCTACTACGGTCCCCTCGCCACGGCCTCCTTCTGG
GCTTTCGGCCTGTTTTTGTGGACATTGATCGAGTACGGCATGCACCGGTTTCTCTTCCACGTCGATGACTATTTG
CCCGACAACCGAGTCGGCATCACGGCGCACTTCTTGCTGCATGGCGTCCATCACTACCTCCCCATGGACAAATAC
CGTCTGGTGATGCCGCCCACTCTTTTCGTCGTTCTTGCGACTCCCTTTTGGCGCCTGGCACATGTTCTCCTCTCC
TTCGATTGGCACGCGGCAACGGCAGTCTTCTGCGGCGGCATCTTTGGCTACATCTGCTACGACCTGACGCACTAC
TTTTTGCACCACCAGAACCTCCCGCTGTGGTACAAGCAGCTCAAGAAGTACCACTTGCAGCATCACTTTCTCGAT
TACGAGCTAGGCTTCGGAGTCACGAGCAAATTCTGGGACACCGTCTTCGGCACAGAGCTGCAGCCCATTAAGACA
AGTGCTACGAATAGCATATTT
Transcript >Ophio5|6621
ATGCCTTCGAGGACGCTGCCGACGCTGACTCGCGCCGAGGTGCAATCGCACGACTCTACTGCCTCGTGCTACGTC
ACCATTGGCTCCAAGGTCTACGATGTCACCGACTTCCTTTCCGACCACCCCGGCGGCGCCCATCTCATCCTAGAA
TACGCCGGCAAGGATGTCGAGGCTATTCTTCAGGATCCCGCCTCGCACCCCCACTCCGAGGCCGCCTACGAGGTC
CTCGACGACTCCTTGGTCGGCTTTGTCGCCTCGCCAAAGGCCGTCGTGGCCACTCCTGTCACCACTGGCGCCGTC
GCGGCTCCCGGCAAGTCCGGCTCCGACCCCGTCCCCCAGGTCCACCCCCGCACCGGCATGTCGTGCGAGGGCGAC
TTGTCCAAGGAGACCGATTACAGCCAGGACTACAAGAAGCACAAGTTTCTGGACCTTAGCAAGCCGCTCTTCCCT
CAGGTCTGGTACGGCGGCTTCAGCAAAGAATTCTATCTCGACCAGGTCCACCGCCCGCGCCACTACAAGGGCGGC
AAGTCGGCGCCTTTGTTTGGCAACTTCCTTGAGCCGCTCACCAAGACGCCGTGGTGGCTTATTCCTACTCTTTGG
CTGCCCTGTGTCGCATACGGCACCTATCTCGCCTCCCAAGGCTACTACGGTCCCCTCGCCACGGCCTCCTTCTGG
GCTTTCGGCCTGTTTTTGTGGACATTGATCGAGTACGGCATGCACCGGTTTCTCTTCCACGTCGATGACTATTTG
CCCGACAACCGAGTCGGCATCACGGCGCACTTCTTGCTGCATGGCGTCCATCACTACCTCCCCATGGACAAATAC
CGTCTGGTGATGCCGCCCACTCTTTTCGTCGTTCTTGCGACTCCCTTTTGGCGCCTGGCACATGTTCTCCTCTCC
TTCGATTGGCACGCGGCAACGGCAGTCTTCTGCGGCGGCATCTTTGGCTACATCTGCTACGACCTGACGCACTAC
TTTTTGCACCACCAGAACCTCCCGCTGTGGTACAAGCAGCTCAAGAAGTACCACTTGCAGCATCACTTTCTCGAT
TACGAGCTAGGCTTCGGAGTCACGAGCAAATTCTGGGACACCGTCTTCGGCACAGAGCTGCAGCCCATTAAGACA
AGTGCTACGAATAGCATATTTTAA
Gene >Ophio5|6621
ATGCCTTCGAGGACGCTGCCGACGCTGACTCGCGCCGAGGTGCAATCGCACGACTCTACTGCCTCGTGCTACGTC
ACCATTGGCTCCAAGGTCTACGATGTCACCGACTTCCTTTCCGACCACCCCGGCGGCGCCCATCTCATCCTAGAA
TACGCCGGCAAGGATGTCGAGGCTATTCTTCAGGATCCCGCCTCGCACCCCCACTCCGAGGCCGCCTACGAGGTC
CTCGACGACTCCTTGGTCGGCTTTGTCGCCTCGCCAAAGGCCGTCGTGGCCACTCCTGTCACCACTGGCGCCGTC
GCGGCTCCCGGCAAGTCCGGCTCCGACCCCGTCCCCCAGGTCCACCCCCGCACCGGCATGTCGTGCGAGGGCGAC
TTGTCCAAGGAGACCGATTACAGCCAGGACTACAAGAAGCACAAGTTTCTGGACCTTAGCAAGCCGCTCTTCCCT
CAGGTCTGGTACGGCGGCTTCAGCAAAGAATTCTATCTCGACCAGGTCCACCGCCCGCGCCACTACAAGGGCGGC
AAGTCGGCGCCTTTGTTTGGCAACTTCCTTGAGCCGCTCACCAAGACGCCGTGGTGGCTTATTCCTACTCTTTGG
CTGCCCTGTGTCGCATACGGCACCTATCTCGCCTCCCAAGGCTACTACGGTCCCCTCGCCACGGCCTCCTTCTGG
GCTTTCGGCCTGTTTTTGTGGACATTGATCGAGTACGGCATGCACCGGTTTCTCTTCCACGTCGATGAGTACGTC
GAGGCTCGCTTGCACCTTTCGAGTCCCGCCTTTTGGCTGACCTTTGTCACAGCTATTTGCCCGACAACCGAGTCG
GCATCACGGCGCACTTCTTGCTGCATGGCGTCCATCACTACCTCCCCATGGACAAATACCGTCTGGTGATGCCGC
CCACTCTTTTCGTCGTTCTTGCGACTCCCTTTTGGCGCCTGGCACATGTTCTCCTCTCCTTCGATTGGCACGCGG
CAACGGCAGTCTTCTGCGGCGGCATCTTTGGCTACATCTGCTACGACCTGACGCACTACTTTTTGCACCACCAGA
ACCTCCCGCTGTGGTACAAGCAGCTCAAGAAGTACCACTTGCAGCATCACTTTCTCGATTACGAGCTAGGCTTCG
GAGTCACGAGCAAATTCTGGGACACCGTCTTCGGCACAGAGCTGCAGCCCATTAAGACAAGGTAGCCCGCTTGCA
TCTCTCTTTTGGTATAGCACGGCGTTGGGGCCTGTCCTTTGGGAGCGGGCATGTGAGCACGCAGCGGAGTCTTGT
TCAGTTGCAGAGGCACAAAATTGTCTTGAACTGATGTTGTACAAACCTAGGTAGTGCTACGAATAGCATATTTTA
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail