Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|662
Gene name
Locationscaffold_118:14076..15742
Strand+
Gene length (bp)1666
Transcript length (bp)1512
Coding sequence length (bp)1509
Protein length (aa) 503

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02076 STE3 Pheromone A receptor 3.3E-64 40 331

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P06783|STE3_YEAST Pheromone a factor receptor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE3 PE=1 SV=1 38 360 2.0E-14
sp|P56502|BAR3_SCHCM Pheromone B alpha 3 receptor OS=Schizophyllum commune (strain H4-8 / FGSC 9210) GN=BAR3 PE=3 SV=2 39 331 2.0E-09
sp|P78741|BBR1_SCHCO Pheromone B beta 1 receptor OS=Schizophyllum commune GN=BBR1 PE=3 SV=2 40 251 1.0E-08
sp|P31397|MAP3_SCHPO Pheromone M-factor receptor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=map3 PE=2 SV=1 93 289 8.0E-08
sp|Q92275|BAR1_SCHCO Pheromone B alpha 1 receptor OS=Schizophyllum commune GN=BAR1 PE=3 SV=2 66 282 3.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P06783|STE3_YEAST Pheromone a factor receptor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE3 PE=1 SV=1 38 360 2.0E-14
sp|P56502|BAR3_SCHCM Pheromone B alpha 3 receptor OS=Schizophyllum commune (strain H4-8 / FGSC 9210) GN=BAR3 PE=3 SV=2 39 331 2.0E-09
sp|P78741|BBR1_SCHCO Pheromone B beta 1 receptor OS=Schizophyllum commune GN=BBR1 PE=3 SV=2 40 251 1.0E-08
sp|P31397|MAP3_SCHPO Pheromone M-factor receptor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=map3 PE=2 SV=1 93 289 8.0E-08
sp|Q92275|BAR1_SCHCO Pheromone B alpha 1 receptor OS=Schizophyllum commune GN=BAR1 PE=3 SV=2 66 282 3.0E-06
sp|Q05659|BAR2_SCHCO Pheromone B alpha 2 receptor OS=Schizophyllum commune GN=BAR2 PE=2 SV=4 40 334 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004932 mating-type factor pheromone receptor activity Yes
GO:0016021 integral component of membrane Yes
GO:0007186 G protein-coupled receptor signaling pathway Yes
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0004888 transmembrane signaling receptor activity No
GO:0050794 regulation of cellular process No
GO:0004930 G protein-coupled receptor activity No
GO:0031224 intrinsic component of membrane No
GO:0065007 biological regulation No
GO:0007165 signal transduction No
GO:0038023 signaling receptor activity No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0050789 regulation of biological process No
GO:0060089 molecular transducer activity No
GO:0016503 pheromone receptor activity No
GO:0008528 G protein-coupled peptide receptor activity No
GO:0001653 peptide receptor activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.5

Transmembrane Domains

Domain # Start End Length
1 34 56 22
2 61 83 22
3 103 125 22
4 145 167 22
5 190 212 22
6 243 265 22
7 299 321 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.96 0.0 1.92
CcL In ants, during behavior modification 0.07 0.0 0.27
CcD In ants, recently dead 0.07 0.0 0.27

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 1.0 no
SC16a CcD 1.0 no
CcL CcD 1.0 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|662
MDSHQPQTIRYLSGNQTAVSGSPPYVSASLTHNLILRVTLALAANAVCLVPLRVLRRNGEFAAAVFIISVELLNF
EAVLCSLIWRDDDFSSWWSGHGLCDIVIHIHNAVTALFTSCLLAIMRNLFQQVGLMRAGPLQRSERRRRNLVQAL
IIFPLPIINLTLTAIVAERRYEVGTLIGCSWAPHSSWPNLVFFVFPPVVLSVITVVYAALTYHRFRHIAKMTETA
LSNNLRASRRSQRTKRRLYLMVMAIMLPYLPLVVAVAVANVLQKSGGEHFDFNAVHYHADPPWHVVLFYQSSEIL
WINLNNCYINVLVAIPIFWFFGTTKDAINEYRLAALSVGFGRLFPILRREYDPDRAPCSGTSTGSSHLPVTVAVD
SHSPSPFAKISSSLSSRRLILFRSASPARGPPDPERGSELVAPVSCAQEEDVATSLSRARHDVSVTDPARHRNPF
LFRTRLNFRLPSRPSPEARLAPDLALRPLPPAASFPAWEVAAAAAADVEEMKT
Coding >Ophio5|662
ATGGATTCCCATCAGCCGCAGACGATTCGATACCTGAGCGGGAATCAGACGGCCGTTTCCGGCTCGCCACCCTAC
GTGAGCGCCTCTTTGACACACAACCTGATTCTACGCGTGACGCTGGCGCTGGCGGCCAACGCCGTGTGCCTTGTG
CCGCTGCGGGTGCTTCGTCGTAATGGAGAGTTTGCCGCGGCCGTCTTCATCATCTCGGTCGAGCTGCTGAATTTC
GAAGCGGTGCTCTGCTCGCTCATCTGGCGTGACGACGACTTCTCGTCTTGGTGGTCTGGCCACGGCCTATGCGAC
ATCGTCATCCATATCCATAACGCCGTCACCGCCCTCTTTACCAGCTGTCTGCTCGCCATCATGCGAAACCTCTTC
CAGCAGGTCGGCCTCATGCGAGCCGGGCCTCTTCAACGCAGCGAGAGGCGCCGTCGCAACCTCGTCCAGGCCCTC
ATCATCTTCCCCCTGCCCATAATCAATCTCACCCTGACGGCCATCGTCGCCGAACGTCGCTACGAGGTCGGCACG
CTTATAGGCTGCAGCTGGGCGCCGCATTCTTCCTGGCCCAACTTGGTCTTCTTCGTCTTCCCTCCGGTCGTGCTC
TCCGTCATCACCGTCGTTTATGCAGCTCTCACATATCATCGTTTCCGCCACATTGCCAAGATGACCGAGACGGCC
CTGTCCAATAACCTCAGAGCGAGCCGACGCAGTCAGCGGACCAAGCGCCGGCTTTACCTCATGGTCATGGCCATC
ATGTTGCCTTATCTGCCCCTGGTCGTCGCCGTTGCCGTCGCAAACGTGCTGCAGAAATCCGGCGGAGAGCACTTC
GACTTCAACGCCGTCCATTATCACGCTGACCCGCCCTGGCATGTCGTCCTCTTCTATCAGTCGTCCGAGATCTTG
TGGATCAACTTGAACAACTGCTACATCAACGTCCTCGTCGCCATCCCTATCTTTTGGTTCTTCGGGACCACCAAG
GACGCCATTAACGAGTACCGCCTCGCTGCCCTCTCCGTTGGCTTCGGCCGCCTCTTCCCCATTCTCCGGCGCGAG
TACGACCCGGACAGGGCCCCTTGCTCCGGCACGTCGACGGGGTCGAGCCATCTGCCGGTGACTGTGGCTGTGGAT
AGCCACTCCCCTTCCCCCTTCGCCAAAATCAGCTCTTCTCTCTCGTCCCGTCGCCTCATTCTCTTCCGCTCTGCC
TCTCCCGCCCGGGGACCCCCTGACCCAGAGCGCGGCAGCGAACTCGTCGCTCCCGTCTCATGTGCACAAGAAGAA
GACGTCGCTACCAGTCTCTCAAGGGCACGGCACGACGTTTCTGTCACGGATCCTGCCCGTCACCGCAACCCCTTT
CTCTTCCGCACCCGTCTTAATTTCCGTCTACCATCTCGGCCCTCGCCCGAAGCACGTCTCGCGCCTGACCTTGCT
CTTCGCCCTCTTCCACCCGCGGCCTCTTTCCCTGCTTGGGAGGTCGCCGCCGCCGCCGCCGCAGACGTGGAGGAG
ATGAAGACT
Transcript >Ophio5|662
ATGGATTCCCATCAGCCGCAGACGATTCGATACCTGAGCGGGAATCAGACGGCCGTTTCCGGCTCGCCACCCTAC
GTGAGCGCCTCTTTGACACACAACCTGATTCTACGCGTGACGCTGGCGCTGGCGGCCAACGCCGTGTGCCTTGTG
CCGCTGCGGGTGCTTCGTCGTAATGGAGAGTTTGCCGCGGCCGTCTTCATCATCTCGGTCGAGCTGCTGAATTTC
GAAGCGGTGCTCTGCTCGCTCATCTGGCGTGACGACGACTTCTCGTCTTGGTGGTCTGGCCACGGCCTATGCGAC
ATCGTCATCCATATCCATAACGCCGTCACCGCCCTCTTTACCAGCTGTCTGCTCGCCATCATGCGAAACCTCTTC
CAGCAGGTCGGCCTCATGCGAGCCGGGCCTCTTCAACGCAGCGAGAGGCGCCGTCGCAACCTCGTCCAGGCCCTC
ATCATCTTCCCCCTGCCCATAATCAATCTCACCCTGACGGCCATCGTCGCCGAACGTCGCTACGAGGTCGGCACG
CTTATAGGCTGCAGCTGGGCGCCGCATTCTTCCTGGCCCAACTTGGTCTTCTTCGTCTTCCCTCCGGTCGTGCTC
TCCGTCATCACCGTCGTTTATGCAGCTCTCACATATCATCGTTTCCGCCACATTGCCAAGATGACCGAGACGGCC
CTGTCCAATAACCTCAGAGCGAGCCGACGCAGTCAGCGGACCAAGCGCCGGCTTTACCTCATGGTCATGGCCATC
ATGTTGCCTTATCTGCCCCTGGTCGTCGCCGTTGCCGTCGCAAACGTGCTGCAGAAATCCGGCGGAGAGCACTTC
GACTTCAACGCCGTCCATTATCACGCTGACCCGCCCTGGCATGTCGTCCTCTTCTATCAGTCGTCCGAGATCTTG
TGGATCAACTTGAACAACTGCTACATCAACGTCCTCGTCGCCATCCCTATCTTTTGGTTCTTCGGGACCACCAAG
GACGCCATTAACGAGTACCGCCTCGCTGCCCTCTCCGTTGGCTTCGGCCGCCTCTTCCCCATTCTCCGGCGCGAG
TACGACCCGGACAGGGCCCCTTGCTCCGGCACGTCGACGGGGTCGAGCCATCTGCCGGTGACTGTGGCTGTGGAT
AGCCACTCCCCTTCCCCCTTCGCCAAAATCAGCTCTTCTCTCTCGTCCCGTCGCCTCATTCTCTTCCGCTCTGCC
TCTCCCGCCCGGGGACCCCCTGACCCAGAGCGCGGCAGCGAACTCGTCGCTCCCGTCTCATGTGCACAAGAAGAA
GACGTCGCTACCAGTCTCTCAAGGGCACGGCACGACGTTTCTGTCACGGATCCTGCCCGTCACCGCAACCCCTTT
CTCTTCCGCACCCGTCTTAATTTCCGTCTACCATCTCGGCCCTCGCCCGAAGCACGTCTCGCGCCTGACCTTGCT
CTTCGCCCTCTTCCACCCGCGGCCTCTTTCCCTGCTTGGGAGGTCGCCGCCGCCGCCGCCGCAGACGTGGAGGAG
ATGAAGACTTGA
Gene >Ophio5|662
ATGGATTCCCATCAGCCGCAGACGATTCGATACCTGAGCGGGAATCAGACGGCCGTTTCCGGCTCGCCACCCTAC
GTGAGCGCCTCTTTGACACACAACCTGATTCTACGCGTGACGCTGGCGCTGGCGGCCAACGCCGTGTGCCTTGTG
CCGCTGCGGGTGCTTCGTCGTAATGGAGAGTTTGCCGCGGCCGTCTTCATCATCTCGGTCGAGCTGCTGAATTTC
GAAGCGGTGCTCTGCTCGCTCATCTGGCGTGACGACGACTTCTCGTCTTGGTGGTCTGGCCACGGCCTATGCGAC
ATCGTCATCCATATCCATAACGCCGTCACCGCCCTCTTTACCAGCTGTCTGCTCGCCATCATGCGAAACCTCTTC
CAGCAGGTCGGCCTCATGCGAGCCGGGCCTCTTCAACGCAGCGAGAGGCGCCGTCGCAACCTCGTCCAGGCCCTC
ATCATCTTCCCCCTGCCCATAATCAATCTCACCCTGACGGCCATCGTCGCCGAACGTCGCTACGAGGTCGGCACG
CTTATAGGCTGCAGCTGGGCGCCGCATTCTTCCTGGCCCAACTTGGTCTTCTTCGTCTTCCCTCCGGTCGTGCTC
TCCGTCATCACCGTCGTTTATGCAGGTAAGTCCTCGTCATGACAAGGAAAAGAAAAAGGGGAGCTTTTTCTTTTG
ACTGACACAATGGTGATGAATACAGCTCTCACATATCATCGTTTCCGCCACATTGCCAAGATGACCGAGACGGCC
CTGTCCAATAACCTCAGAGCGAGCCGACGCAGTCAGCGGACCAAGCGCCGGCTTTACCTCATGGTCATGGCCATC
ATGTTGCCTTATCTGCCCCTGGTCGTCGCCGTTGCCGTCGCAAACGTGCTGCAGAAATCCGGCGGAGAGCACTTC
GACTTCAACGCCGTCCATTATCACGCTGACCCGCCCTGGCATGTCGTCCTCTTCTATCAGTCGTCCGAGATCTTG
TGGATCAACTTGAACAACTGCTACATCAACGTCCTCGTCGCCATCCCTATCTTTTGGTTCTTCGGGACCACCAAG
GACGCCATTAACGAGTACCGCCTCGCTGCCCTCTCCGTTGGCTTCGGCCGCCTCTTCCCCATTCTCCGGCGCGAG
TACGACCCGGACAGGGCCCCTTGCTCCGGCACGTCGACGGGGTCGAGCCATCTGCCGGTGACTGTGGCTGTGGAT
AGGTGAGTTGACTTCAATTGCATCGGCCTCTCTCCCCCTTTTTTTTTTCTTCTAATGGGCTGACTGACTGTGCTT
TCCTAGCCACTCCCCTTCCCCCTTCGCCAAAATCAGCTCTTCTCTCTCGTCCCGTCGCCTCATTCTCTTCCGCTC
TGCCTCTCCCGCCCGGGGACCCCCTGACCCAGAGCGCGGCAGCGAACTCGTCGCTCCCGTCTCATGTGCACAAGA
AGAAGACGTCGCTACCAGTCTCTCAAGGGCACGGCACGACGTTTCTGTCACGGATCCTGCCCGTCACCGCAACCC
CTTTCTCTTCCGCACCCGTCTTAATTTCCGTCTACCATCTCGGCCCTCGCCCGAAGCACGTCTCGCGCCTGACCT
TGCTCTTCGCCCTCTTCCACCCGCGGCCTCTTTCCCTGCTTGGGAGGTCGCCGCCGCCGCCGCCGCAGACGTGGA
GGAGATGAAGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail