Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6617
Gene name
Locationscaffold_59:35921..37882
Strand+
Gene length (bp)1961
Transcript length (bp)1749
Coding sequence length (bp)1746
Protein length (aa) 582

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00481 PP2C Protein phosphatase 2C 6.8E-31 370 533

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14156|PP2C4_SCHPO Protein phosphatase 2C homolog 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc4 PE=1 SV=2 150 579 2.0E-48
sp|Q8BXN7|PPM1K_MOUSE Protein phosphatase 1K, mitochondrial OS=Mus musculus GN=Ppm1k PE=1 SV=1 366 550 3.0E-23
sp|P25646|PDP2_YEAST [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC6 PE=1 SV=2 397 550 6.0E-23
sp|Q6ING9|PPM1K_XENLA Protein phosphatase 1K, mitochondrial OS=Xenopus laevis GN=ppm1k PE=2 SV=1 366 550 2.0E-22
sp|Q2PC20|PPM1K_BOVIN Protein phosphatase 1K, mitochondrial OS=Bos taurus GN=PPM1K PE=2 SV=1 366 550 1.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14156|PP2C4_SCHPO Protein phosphatase 2C homolog 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc4 PE=1 SV=2 150 579 2.0E-48
sp|Q8BXN7|PPM1K_MOUSE Protein phosphatase 1K, mitochondrial OS=Mus musculus GN=Ppm1k PE=1 SV=1 366 550 3.0E-23
sp|P25646|PDP2_YEAST [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC6 PE=1 SV=2 397 550 6.0E-23
sp|Q6ING9|PPM1K_XENLA Protein phosphatase 1K, mitochondrial OS=Xenopus laevis GN=ppm1k PE=2 SV=1 366 550 2.0E-22
sp|Q2PC20|PPM1K_BOVIN Protein phosphatase 1K, mitochondrial OS=Bos taurus GN=PPM1K PE=2 SV=1 366 550 1.0E-21
sp|Q8N3J5|PPM1K_HUMAN Protein phosphatase 1K, mitochondrial OS=Homo sapiens GN=PPM1K PE=1 SV=1 366 550 1.0E-21
sp|P40371|PP2C1_SCHPO Protein phosphatase 2C homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc1 PE=2 SV=1 372 547 1.0E-15
sp|Q8BHN0|PPM1L_MOUSE Protein phosphatase 1L OS=Mus musculus GN=Ppm1l PE=1 SV=1 370 547 2.0E-15
sp|Q5SGD2|PPM1L_HUMAN Protein phosphatase 1L OS=Homo sapiens GN=PPM1L PE=1 SV=1 370 547 2.0E-15
sp|Q4PSE8|P2C71_ARATH Probable protein phosphatase 2C 71 OS=Arabidopsis thaliana GN=At5g24940 PE=2 SV=1 397 547 6.0E-15
sp|A5PJZ2|PPM1L_BOVIN Protein phosphatase 1L OS=Bos taurus GN=PPM1L PE=2 SV=1 370 547 7.0E-15
sp|Q0JAA0|P2C44_ORYSJ Probable protein phosphatase 2C 44 OS=Oryza sativa subsp. japonica GN=Os04g0609600 PE=2 SV=1 371 547 7.0E-15
sp|Q8L7I4|P2C17_ARATH Probable protein phosphatase 2C 17 OS=Arabidopsis thaliana GN=At1g78200 PE=2 SV=1 371 547 1.0E-14
sp|Q8RXV3|P2C59_ARATH Probable protein phosphatase 2C 59 OS=Arabidopsis thaliana GN=WIN2 PE=1 SV=1 397 564 2.0E-14
sp|Q67UX7|P2C10_ORYSJ Probable protein phosphatase 2C 10 OS=Oryza sativa subsp. japonica GN=Os02g0149800 PE=2 SV=1 372 547 3.0E-13
sp|Q8VZN9|P2C11_ARATH Probable protein phosphatase 2C 11 OS=Arabidopsis thaliana GN=At1g43900 PE=2 SV=1 397 547 3.0E-13
sp|Q7XR06|P2C45_ORYSJ Probable protein phosphatase 2C 45 OS=Oryza sativa subsp. japonica GN=Os04g0659500 PE=2 SV=2 397 547 3.0E-13
sp|Q93YW5|P2C58_ARATH Probable protein phosphatase 2C 58 OS=Arabidopsis thaliana GN=At4g28400 PE=2 SV=1 370 547 4.0E-13
sp|Q53Q11|P2C74_ORYSJ Probable protein phosphatase 2C 74 OS=Oryza sativa subsp. japonica GN=Os11g0242200 PE=3 SV=1 370 530 4.0E-13
sp|Q5Z6F5|P2C59_ORYSJ Probable protein phosphatase 2C 59 OS=Oryza sativa subsp. japonica GN=Os06g0698300 PE=2 SV=1 372 547 8.0E-13
sp|Q6L5C4|P2C52_ORYSJ Probable protein phosphatase 2C 52 OS=Oryza sativa subsp. japonica GN=Os05g0587100 PE=2 SV=1 372 547 1.0E-12
sp|Q0JL75|P2C07_ORYSJ Probable protein phosphatase 2C 7 OS=Oryza sativa subsp. japonica GN=Os01g0618200 PE=2 SV=2 397 547 2.0E-12
sp|Q8LAY8|P2C69_ARATH Probable protein phosphatase 2C 69 OS=Arabidopsis thaliana GN=At5g10740 PE=2 SV=1 397 547 3.0E-12
sp|Q6Z8B9|P2C12_ORYSJ Probable protein phosphatase 2C 12 OS=Oryza sativa subsp. japonica GN=Os02g0224100 PE=2 SV=1 397 532 3.0E-12
sp|Q9LDA7|P2C39_ARATH Probable protein phosphatase 2C 39 OS=Arabidopsis thaliana GN=At3g15260 PE=2 SV=1 370 531 5.0E-12
sp|Q0D673|P2C62_ORYSJ Probable protein phosphatase 2C 62 OS=Oryza sativa subsp. japonica GN=Os07g0507000 PE=2 SV=1 370 547 7.0E-12
sp|Q6L482|P2C48_ORYSJ Probable protein phosphatase 2C 48 OS=Oryza sativa subsp. japonica GN=Os05g0358500 PE=2 SV=1 397 542 1.0E-11
sp|Q94AT1|P2C76_ARATH Probable protein phosphatase 2C 76 OS=Arabidopsis thaliana GN=At5g53140 PE=2 SV=1 397 547 2.0E-11
sp|Q9SIU8|P2C20_ARATH Probable protein phosphatase 2C 20 OS=Arabidopsis thaliana GN=PPC3-1.2 PE=1 SV=3 370 544 3.0E-11
sp|Q6EN45|P2C13_ORYSJ Probable protein phosphatase 2C 13 OS=Oryza sativa subsp. japonica GN=Os02g0255100 PE=2 SV=1 397 547 3.0E-11
sp|Q8RX37|P2C02_ARATH Probable protein phosphatase 2C 2 OS=Arabidopsis thaliana GN=At1g07160 PE=2 SV=1 370 531 1.0E-10
sp|Q653S3|P2C70_ORYSJ Probable protein phosphatase 2C 70 OS=Oryza sativa subsp. japonica GN=Os09g0558000 PE=2 SV=2 372 547 1.0E-10
sp|O81716|P2C21_ARATH Probable protein phosphatase 2C 21 OS=Arabidopsis thaliana GN=PPC4-2 PE=1 SV=1 372 541 1.0E-10
sp|Q2RBJ6|P2C73_ORYSJ Probable protein phosphatase 2C 73 OS=Oryza sativa subsp. japonica GN=Os11g0109000 PE=2 SV=1 397 531 2.0E-10
sp|Q0IIF0|ILKAP_BOVIN Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Bos taurus GN=ILKAP PE=2 SV=1 369 548 3.0E-10
sp|Q2R637|P2C75_ORYSJ Probable protein phosphatase 2C 75 OS=Oryza sativa subsp. japonica GN=Os11g0417400 PE=2 SV=1 397 532 5.0E-10
sp|Q2QWE3|P2C77_ORYSJ Probable protein phosphatase 2C 77 OS=Oryza sativa subsp. japonica GN=Os12g0198200 PE=3 SV=1 369 508 6.0E-10
sp|Q67UP9|P2C58_ORYSJ Probable protein phosphatase 2C 58 OS=Oryza sativa subsp. japonica GN=Os06g0651600 PE=2 SV=1 372 532 7.0E-10
sp|Q9XEE8|P2C30_ARATH Probable protein phosphatase 2C 30 OS=Arabidopsis thaliana GN=PP2C5 PE=2 SV=1 370 514 8.0E-10
sp|Q0WRB2|P2C73_ARATH Probable protein phosphatase 2C 73 OS=Arabidopsis thaliana GN=PPC6-7 PE=2 SV=1 396 531 9.0E-10
sp|Q9M9W9|P2C34_ARATH Probable protein phosphatase 2C 34 OS=Arabidopsis thaliana GN=At3g05640 PE=2 SV=1 396 542 1.0E-09
sp|Q7XQU7|P2C41_ORYSJ Probable protein phosphatase 2C 41 OS=Oryza sativa subsp. japonica GN=Os04g0452000 PE=2 SV=2 370 547 2.0E-09
sp|O80871|P2C25_ARATH Probable protein phosphatase 2C 25 OS=Arabidopsis thaliana GN=At2g30020 PE=1 SV=1 370 530 2.0E-09
sp|A0BLX0|PP2C2_PARTE Probable protein phosphatase 2C 2 OS=Paramecium tetraurelia GN=GSPATT00030171001 PE=3 SV=1 372 536 3.0E-09
sp|P49444|PP2C1_PARTE Protein phosphatase 2C 1 OS=Paramecium tetraurelia GN=GSPATT00029903001 PE=1 SV=2 372 536 3.0E-09
sp|Q5R522|PPM1K_PONAB Protein phosphatase 1K, mitochondrial OS=Pongo abelii GN=PPM1K PE=2 SV=1 366 509 3.0E-09
sp|Q8H4S6|P2C64_ORYSJ Probable protein phosphatase 2C 64 OS=Oryza sativa subsp. japonica GN=Os07g0566200 PE=2 SV=2 395 530 5.0E-09
sp|Q9H0C8|ILKAP_HUMAN Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Homo sapiens GN=ILKAP PE=1 SV=1 369 548 8.0E-09
sp|O82637|P2C61_ARATH Probable protein phosphatase 2C 61 OS=Arabidopsis thaliana GN=At4g32950 PE=3 SV=1 397 527 9.0E-09
sp|Q8R0F6|ILKAP_MOUSE Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Mus musculus GN=Ilkap PE=1 SV=1 369 548 1.0E-08
sp|Q9SA22|P2C06_ARATH Probable protein phosphatase 2C 6 OS=Arabidopsis thaliana GN=At1g16220 PE=2 SV=1 397 531 1.0E-08
sp|Q9XGZ9|P2C72_ARATH Probable protein phosphatase 2C 72 OS=Arabidopsis thaliana GN=At5g26010 PE=2 SV=2 397 513 1.0E-08
sp|Q9Z1Z6|ILKAP_RAT Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Rattus norvegicus GN=Ilkap PE=2 SV=1 369 548 1.0E-08
sp|P35182|PP2C1_YEAST Protein phosphatase 2C homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC1 PE=1 SV=1 397 547 1.0E-08
sp|Q9SZ53|P2C60_ARATH Probable protein phosphatase 2C 60 OS=Arabidopsis thaliana GN=At4g31860 PE=2 SV=1 372 547 2.0E-08
sp|Q9FG61|P2C74_ARATH Probable protein phosphatase 2C 74 OS=Arabidopsis thaliana GN=At5g36250 PE=1 SV=1 397 531 2.0E-08
sp|P39966|PP2C2_YEAST Protein phosphatase 2C homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC2 PE=1 SV=1 381 571 2.0E-08
sp|Q5JJY4|P2C04_ORYSJ Protein kinase and PP2C-like domain-containing protein OS=Oryza sativa subsp. japonica GN=Os01g0541900 PE=2 SV=1 389 547 2.0E-08
sp|Q8RXZ4|P2C18_ARATH Probable protein phosphatase 2C 18 OS=Arabidopsis thaliana GN=At1g79630 PE=2 SV=1 397 531 2.0E-08
sp|Q7XU84|P2C42_ORYSJ Probable protein phosphatase 2C 42 OS=Oryza sativa subsp. japonica GN=Os04g0500900 PE=3 SV=4 372 514 3.0E-08
sp|P35813|PPM1A_HUMAN Protein phosphatase 1A OS=Homo sapiens GN=PPM1A PE=1 SV=1 370 514 3.0E-08
sp|P35814|PPM1A_RABIT Protein phosphatase 1A OS=Oryctolagus cuniculus GN=PPM1A PE=2 SV=1 370 514 4.0E-08
sp|P20650|PPM1A_RAT Protein phosphatase 1A OS=Rattus norvegicus GN=Ppm1a PE=1 SV=1 370 514 4.0E-08
sp|Q9LNW3|P2C03_ARATH Protein phosphatase 2C 3 OS=Arabidopsis thaliana GN=AIP1 PE=1 SV=1 373 514 4.0E-08
sp|P49443|PPM1A_MOUSE Protein phosphatase 1A OS=Mus musculus GN=Ppm1a PE=1 SV=1 370 514 4.0E-08
sp|A3A8W2|P2C21_ORYSJ Probable protein phosphatase 2C 21 OS=Oryza sativa subsp. japonica GN=Os02g0606900 PE=2 SV=2 372 547 5.0E-08
sp|P34221|PP2C3_YEAST Protein phosphatase 2C homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC3 PE=1 SV=4 372 513 5.0E-08
sp|A3CCP9|P2C76_ORYSJ Putative protein phosphatase 2C 76 OS=Oryza sativa subsp. japonica GN=Os11g0586001 PE=3 SV=2 367 548 5.0E-08
sp|Q9LME4|P2C09_ARATH Probable protein phosphatase 2C 9 OS=Arabidopsis thaliana GN=At1g22280 PE=1 SV=1 370 547 5.0E-08
sp|Q9LRZ4|P2C41_ARATH Probable protein phosphatase 2C 41 OS=Arabidopsis thaliana GN=At3g16800 PE=2 SV=1 397 533 5.0E-08
sp|Q5UPZ7|YR307_MIMIV PP2C-like domain-containing protein R307 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R307 PE=1 SV=1 392 515 7.0E-08
sp|P49596|PP2C2_CAEEL Probable protein phosphatase 2C T23F11.1 OS=Caenorhabditis elegans GN=ppm-2 PE=3 SV=2 372 515 7.0E-08
sp|P36993|PPM1B_MOUSE Protein phosphatase 1B OS=Mus musculus GN=Ppm1b PE=1 SV=1 370 535 1.0E-07
sp|O62829|PPM1A_BOVIN Protein phosphatase 1A OS=Bos taurus GN=PPM1A PE=2 SV=1 370 514 2.0E-07
sp|Q8GY60|P2C52_ARATH Probable protein phosphatase 2C 52 OS=Arabidopsis thaliana GN=At4g03415 PE=2 SV=1 395 513 2.0E-07
sp|Q3EAF9|P2C49_ARATH Probable protein phosphatase 2C 49 OS=Arabidopsis thaliana GN=At3g62260 PE=2 SV=1 397 552 2.0E-07
sp|Q7XW27|P2C38_ORYSJ Probable protein phosphatase 2C 38 OS=Oryza sativa subsp. japonica GN=Os04g0321800 PE=2 SV=2 397 530 3.0E-07
sp|Q54WS9|Y9461_DICDI Probable protein phosphatase DDB_G0279461 OS=Dictyostelium discoideum GN=DDB_G0279461 PE=3 SV=2 372 547 4.0E-07
sp|Q9FXE4|P2C14_ARATH Probable protein phosphatase 2C 14 OS=Arabidopsis thaliana GN=At1g67820 PE=2 SV=2 397 534 6.0E-07
sp|Q10MX1|P2C32_ORYSJ Probable protein phosphatase 2C 32 OS=Oryza sativa subsp. japonica GN=Os03g0292100 PE=2 SV=1 397 514 9.0E-07
sp|Q84JD5|P2C68_ARATH Probable protein phosphatase 2C 68 OS=Arabidopsis thaliana GN=At5g06750 PE=2 SV=1 394 534 1.0E-06
sp|Q65XK7|P2C51_ORYSJ Probable protein phosphatase 2C 51 OS=Oryza sativa subsp. japonica GN=Os05g0572700 PE=2 SV=1 372 514 1.0E-06
sp|Q9FLI3|P2C75_ARATH Probable protein phosphatase 2C 75 OS=Arabidopsis thaliana GN=AHG1 PE=2 SV=1 397 514 1.0E-06
sp|Q940A2|P2C31_ARATH Protein kinase and PP2C-like domain-containing protein OS=Arabidopsis thaliana GN=At2g40860/At2g40870 PE=2 SV=1 389 547 1.0E-06
sp|Q9FIF5|P2C78_ARATH Probable protein phosphatase 2C 78 OS=Arabidopsis thaliana GN=At5g59220 PE=2 SV=1 373 514 1.0E-06
sp|Q8H2T0|P2C65_ORYSJ Probable protein phosphatase 2C 65 OS=Oryza sativa subsp. japonica GN=Os07g0646100 PE=2 SV=1 399 541 3.0E-06
sp|Q84JI0|P2C30_ORYSJ Probable protein phosphatase 2C 30 OS=Oryza sativa subsp. japonica GN=Os03g0268600 PE=2 SV=1 397 514 5.0E-06
sp|Q9ZW21|P2C24_ARATH Probable protein phosphatase 2C 24 OS=Arabidopsis thaliana GN=At2g29380 PE=2 SV=1 373 507 6.0E-06
sp|Q9LR65|P2C01_ARATH Probable protein phosphatase 2C 1 OS=Arabidopsis thaliana GN=PPC6-6 PE=1 SV=1 395 531 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004722 protein serine/threonine phosphatase activity Yes
GO:0004721 phosphoprotein phosphatase activity No
GO:0016791 phosphatase activity No
GO:0016787 hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0003824 catalytic activity No
GO:0042578 phosphoric ester hydrolase activity No
GO:0003674 molecular_function No
GO:0016788 hydrolase activity, acting on ester bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6617
MFHDASSASLSPNSRPHSPLHLPPIFSSSSTSARRWTRFIPWTCHAPAALDFNRARAAEAHPPPPNHPLPSSSSM
ASVANRLAGHASPTVFIRAFHTYFVTHLPSSSLHPDSPVSPHKLPRDASTPHTPSPGAAPAVVLPNMPGRDLTVV
RIPLRRAKHHFGSYTCRGSRPYNEDADQAGIVEMPAFATRAPLSVKQKPGEATSADGASGDPQIFYFALFDGHGG
SQCSHFLRDELHGYIEEAAARLGLQSSLRKKKPGRDTHARPPSNDTTPARLEQELVAEYKNSIGGYYRRFSPDHF
GERAAGDESAPSIEASLTYAFLRADLDFVAAQARKPDPDDFDMPVNHDEILGVPHATPSGHGIGGATRFKGGSTA
SIALVSTPTPTPFWHPAARSTLLVAHVGDSRILICDTASGRAHPLTSDHHPSTPTESRRLRRYGPTGSMVSGDSF
GEERIAGLANSRAFGDVGSKRLGVSAEPEIVRVDLGPAQYAFLVLVSDGVSGSLADQEMVDIIKEAPTPEQGARN
VVDYAVEVSVDGDNATCQVVRLGGWERRSEGGLGSLGTKEIRDARRAEAQDPRRGKQ
Coding >Ophio5|6617
ATGTTCCATGACGCTTCATCTGCCTCCCTAAGTCCCAACAGTCGCCCTCATTCGCCGCTTCACCTTCCACCTATT
TTCTCCTCCTCCTCCACGTCGGCTCGGCGCTGGACTCGCTTCATCCCATGGACCTGCCACGCACCGGCCGCACTC
GATTTCAACCGCGCGAGAGCTGCTGAGGCTCACCCGCCGCCGCCGAATCATCCTCTTCCCTCCTCCAGCTCAATG
GCCTCTGTGGCAAACCGCCTCGCCGGCCATGCTTCGCCCACCGTCTTCATCCGCGCCTTTCACACTTACTTCGTC
ACTCACCTCCCATCCTCGTCTCTTCACCCGGACTCGCCCGTCTCTCCTCACAAGCTTCCCCGCGATGCTTCGACA
CCTCATACGCCCAGTCCCGGCGCCGCGCCGGCCGTCGTGCTGCCCAACATGCCAGGCCGAGACCTGACCGTCGTG
CGTATCCCGCTGCGGCGGGCCAAGCATCACTTCGGCTCCTACACATGCAGGGGTAGCCGACCTTACAACGAGGAC
GCCGACCAGGCCGGTATCGTCGAGATGCCTGCCTTCGCCACCAGGGCTCCCCTGAGCGTCAAACAGAAGCCGGGC
GAGGCCACCTCCGCAGACGGCGCTTCCGGCGACCCCCAGATCTTCTACTTTGCCCTCTTTGACGGCCACGGCGGG
TCGCAGTGCTCTCATTTCCTTCGCGATGAGCTGCACGGATATATAGAGGAGGCCGCCGCTCGTCTGGGCCTGCAG
AGCAGCCTGCGCAAGAAGAAACCCGGGCGCGACACACACGCACGCCCGCCGTCAAACGACACGACGCCCGCCCGG
CTCGAGCAGGAGCTGGTGGCGGAATACAAAAACTCCATCGGCGGCTACTACAGACGCTTCAGCCCGGACCACTTT
GGCGAGCGCGCTGCAGGCGACGAATCGGCCCCCAGCATCGAAGCCAGCCTCACCTACGCCTTTCTCCGCGCCGAC
CTCGATTTCGTGGCGGCTCAGGCGCGAAAGCCCGACCCCGACGATTTCGACATGCCCGTCAACCACGACGAGATC
CTCGGCGTCCCCCACGCCACGCCCTCGGGCCACGGCATCGGCGGCGCAACCCGCTTCAAGGGCGGCTCCACGGCC
TCCATCGCCCTCGTCTCGACGCCGACGCCGACGCCGTTTTGGCACCCGGCCGCCCGGTCGACACTGCTGGTGGCG
CACGTCGGCGACAGTCGCATCCTCATCTGCGACACGGCCTCGGGAAGAGCCCACCCGCTGACGTCGGATCATCAC
CCGTCGACGCCGACGGAGAGCCGCCGGCTTCGGCGCTACGGCCCCACCGGCTCCATGGTCTCGGGCGACAGCTTC
GGCGAGGAGCGCATCGCCGGCCTGGCAAACAGTCGCGCCTTCGGTGACGTGGGCAGCAAACGGCTCGGCGTATCC
GCCGAACCGGAAATCGTCCGTGTCGACCTGGGCCCCGCCCAGTACGCCTTCCTCGTCCTCGTCAGCGACGGCGTC
TCGGGCTCGCTGGCCGATCAAGAGATGGTCGATATCATCAAGGAGGCTCCGACCCCGGAACAGGGCGCCCGAAAC
GTCGTCGACTACGCCGTAGAGGTCTCCGTCGACGGCGATAACGCTACCTGCCAGGTCGTCCGTCTCGGCGGCTGG
GAGCGCCGCTCCGAGGGTGGCCTCGGCAGCCTCGGCACCAAGGAGATTCGCGATGCTAGGAGGGCTGAGGCTCAA
GACCCGCGCAGGGGGAAACAA
Transcript >Ophio5|6617
ATGTTCCATGACGCTTCATCTGCCTCCCTAAGTCCCAACAGTCGCCCTCATTCGCCGCTTCACCTTCCACCTATT
TTCTCCTCCTCCTCCACGTCGGCTCGGCGCTGGACTCGCTTCATCCCATGGACCTGCCACGCACCGGCCGCACTC
GATTTCAACCGCGCGAGAGCTGCTGAGGCTCACCCGCCGCCGCCGAATCATCCTCTTCCCTCCTCCAGCTCAATG
GCCTCTGTGGCAAACCGCCTCGCCGGCCATGCTTCGCCCACCGTCTTCATCCGCGCCTTTCACACTTACTTCGTC
ACTCACCTCCCATCCTCGTCTCTTCACCCGGACTCGCCCGTCTCTCCTCACAAGCTTCCCCGCGATGCTTCGACA
CCTCATACGCCCAGTCCCGGCGCCGCGCCGGCCGTCGTGCTGCCCAACATGCCAGGCCGAGACCTGACCGTCGTG
CGTATCCCGCTGCGGCGGGCCAAGCATCACTTCGGCTCCTACACATGCAGGGGTAGCCGACCTTACAACGAGGAC
GCCGACCAGGCCGGTATCGTCGAGATGCCTGCCTTCGCCACCAGGGCTCCCCTGAGCGTCAAACAGAAGCCGGGC
GAGGCCACCTCCGCAGACGGCGCTTCCGGCGACCCCCAGATCTTCTACTTTGCCCTCTTTGACGGCCACGGCGGG
TCGCAGTGCTCTCATTTCCTTCGCGATGAGCTGCACGGATATATAGAGGAGGCCGCCGCTCGTCTGGGCCTGCAG
AGCAGCCTGCGCAAGAAGAAACCCGGGCGCGACACACACGCACGCCCGCCGTCAAACGACACGACGCCCGCCCGG
CTCGAGCAGGAGCTGGTGGCGGAATACAAAAACTCCATCGGCGGCTACTACAGACGCTTCAGCCCGGACCACTTT
GGCGAGCGCGCTGCAGGCGACGAATCGGCCCCCAGCATCGAAGCCAGCCTCACCTACGCCTTTCTCCGCGCCGAC
CTCGATTTCGTGGCGGCTCAGGCGCGAAAGCCCGACCCCGACGATTTCGACATGCCCGTCAACCACGACGAGATC
CTCGGCGTCCCCCACGCCACGCCCTCGGGCCACGGCATCGGCGGCGCAACCCGCTTCAAGGGCGGCTCCACGGCC
TCCATCGCCCTCGTCTCGACGCCGACGCCGACGCCGTTTTGGCACCCGGCCGCCCGGTCGACACTGCTGGTGGCG
CACGTCGGCGACAGTCGCATCCTCATCTGCGACACGGCCTCGGGAAGAGCCCACCCGCTGACGTCGGATCATCAC
CCGTCGACGCCGACGGAGAGCCGCCGGCTTCGGCGCTACGGCCCCACCGGCTCCATGGTCTCGGGCGACAGCTTC
GGCGAGGAGCGCATCGCCGGCCTGGCAAACAGTCGCGCCTTCGGTGACGTGGGCAGCAAACGGCTCGGCGTATCC
GCCGAACCGGAAATCGTCCGTGTCGACCTGGGCCCCGCCCAGTACGCCTTCCTCGTCCTCGTCAGCGACGGCGTC
TCGGGCTCGCTGGCCGATCAAGAGATGGTCGATATCATCAAGGAGGCTCCGACCCCGGAACAGGGCGCCCGAAAC
GTCGTCGACTACGCCGTAGAGGTCTCCGTCGACGGCGATAACGCTACCTGCCAGGTCGTCCGTCTCGGCGGCTGG
GAGCGCCGCTCCGAGGGTGGCCTCGGCAGCCTCGGCACCAAGGAGATTCGCGATGCTAGGAGGGCTGAGGCTCAA
GACCCGCGCAGGGGGAAACAATGA
Gene >Ophio5|6617
ATGTTGTACGAATAGACTTTCGATTAGTCACCCTGCATGCATCGTCAAGGCTTCTGATTGGTCATCACAGACTGC
ACGCCTCTCGACCAGGTGGAAGCGAAGCTAGTTCCTAGGCATCTATTCCCCCTACCATCTCCAGCCATGACGCTT
CATCTGCCTCCCTAAGGTTAGACATCACCTCGTCCGTCGCCTCGTCCAATCGTCTCGTCCGTCATCCATGACGAC
CGCACTCACAGACCAACAGTCCCAACAGTCGCCCTCATTCGCCGCTTCACCTTCCACCTATTTTCTCCTCCTCCT
CCACGTCGGCTCGGCGCTGGACTCGCTTCATCCCATGGACCTGCCACGCACCGGCCGCACTCGATTTCAACCGCG
CGAGAGCTGCTGAGGCTCACCCGCCGCCGCCGAATCATCCTCTTCCCTCCTCCAGCTCAATGGCCTCTGTGGCAA
ACCGCCTCGCCGGCCATGCTTCGCCCACCGTCTTCATCCGCGCCTTTCACACTTACTTCGTCACTCACCTCCCAT
CCTCGTCTCTTCACCCGGACTCGCCCGTCTCTCCTCACAAGCTTCCCCGCGATGCTTCGACACCTCATACGCCCA
GTCCCGGCGCCGCGCCGGCCGTCGTGCTGCCCAACATGCCAGGCCGAGACCTGACCGTCGTGCGTATCCCGCTGC
GGCGGGCCAAGCATCACTTCGGCTCCTACACATGCAGGGGTAGCCGACCTTACAACGAGGACGCCGACCAGGCCG
GTATCGTCGAGATGCCTGCCTTCGCCACCAGGGCTCCCCTGAGCGTCAAACAGAAGCCGGGCGAGGCCACCTCCG
CAGACGGCGCTTCCGGCGACCCCCAGATCTTCTACTTTGCCCTCTTTGACGGCCACGGCGGGTCGCAGTGCTCTC
ATTTCCTTCGCGATGAGCTGCACGGATATATAGAGGAGGCCGCCGCTCGTCTGGGCCTGCAGAGCAGCCTGCGCA
AGAAGAAACCCGGGCGCGACACACACGCACGCCCGCCGTCAAACGACACGACGCCCGCCCGGCTCGAGCAGGAGC
TGGTGGCGGAATACAAAAACTCCATCGGCGGCTACTACAGACGCTTCAGCCCGGACCACTTTGGCGAGCGCGCTG
CAGGCGACGAATCGGCCCCCAGCATCGAAGCCAGCCTCACCTACGCCTTTCTCCGCGCCGACCTCGATTTCGTGG
CGGCTCAGGCGCGAAAGCCCGACCCCGACGATTTCGACATGCCCGTCAACCACGACGAGATCCTCGGCGTCCCCC
ACGCCACGCCCTCGGGCCACGGCATCGGCGGCGCAACCCGCTTCAAGGGCGGCTCCACGGCCTCCATCGCCCTCG
TCTCGACGCCGACGCCGACGCCGTTTTGGCACCCGGCCGCCCGGTCGACACTGCTGGTGGCGCACGTCGGCGACA
GTCGCATCCTCATCTGCGACACGGCCTCGGGAAGAGCCCACCCGCTGACGTCGGATCATCACCCGTCGACGCCGA
CGGAGAGCCGCCGGCTTCGGCGCTACGGCCCCACCGGCTCCATGGTCTCGGGCGACAGCTTCGGCGAGGAGCGCA
TCGCCGGCCTGGCAAACAGTCGCGCCTTCGGTGACGTGGGCAGCAAACGGCTCGGCGTATCCGCCGAACCGGAAA
TCGTCCGTGTCGACCTGGGCCCCGCCCAGTACGCCTTCCTCGTCCTCGTCAGCGACGGCGTCTCGGGCTCGCTGG
CCGATCAAGAGATGGTCGATATCATCAAGGAGGCTCCGACCCCGGAACAGGGCGCCCGAAACGTCGTCGACTACG
CCGTAGAGGTCTCCGTCGACGGCGATAACGCTACCTGCCAGGTCGTCCGTCTCGGCGGCTGGGAGCGCCGCTCCG
AGGGTGGCCTCGGCAGCCTCGGCACCAAGGAGATTCGCGATGCTAGGAGGGCTGAGGCTCAAGACCCGCGCAGGG
GGAAACAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail