Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6615
Gene name
Locationscaffold_59:32902..34162
Strand+
Gene length (bp)1260
Transcript length (bp)1089
Coding sequence length (bp)1086
Protein length (aa) 362

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03239 FTR1 Iron permease FTR1 family 7.9E-78 10 318

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40088|FTR1_YEAST Plasma membrane iron permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FTR1 PE=1 SV=1 17 334 7.0E-105
sp|Q09919|FIP1_SCHPO Plasma membrane iron permease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fip1 PE=1 SV=1 3 361 2.0E-92
sp|P38310|FTH1_YEAST Iron transporter FTH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FTH1 PE=1 SV=2 34 360 4.0E-88
sp|Q1RDK0|EFEU_ECOUT Ferrous iron permease EfeU OS=Escherichia coli (strain UTI89 / UPEC) GN=efeU PE=3 SV=2 12 312 8.0E-09
sp|Q0TJ50|EFEU_ECOL5 Ferrous iron permease EfeU OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=efeU PE=3 SV=1 12 312 8.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40088|FTR1_YEAST Plasma membrane iron permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FTR1 PE=1 SV=1 17 334 7.0E-105
sp|Q09919|FIP1_SCHPO Plasma membrane iron permease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fip1 PE=1 SV=1 3 361 2.0E-92
sp|P38310|FTH1_YEAST Iron transporter FTH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FTH1 PE=1 SV=2 34 360 4.0E-88
sp|Q1RDK0|EFEU_ECOUT Ferrous iron permease EfeU OS=Escherichia coli (strain UTI89 / UPEC) GN=efeU PE=3 SV=2 12 312 8.0E-09
sp|Q0TJ50|EFEU_ECOL5 Ferrous iron permease EfeU OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=efeU PE=3 SV=1 12 312 8.0E-09
sp|Q1CHD3|EFEU_YERPN Ferrous iron permease EfeU OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=efeU PE=3 SV=1 12 310 1.0E-08
sp|Q0WFU0|EFEU_YERPE Ferrous iron permease EfeU OS=Yersinia pestis GN=efeU PE=3 SV=1 12 310 1.0E-08
sp|Q1C8M3|EFEU_YERPA Ferrous iron permease EfeU OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=efeU PE=3 SV=1 12 310 1.0E-08
sp|Q66BP6|EFEU_YERPS Ferrous iron permease EfeU OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=efeU PE=3 SV=1 12 310 1.0E-08
sp|Q3Z398|EFEU_SHISS Ferrous iron permease EfeU OS=Shigella sonnei (strain Ss046) GN=efeU PE=3 SV=2 12 310 2.0E-08
sp|Q8XAS8|EFEU_ECO57 Ferrous iron permease EfeU OS=Escherichia coli O157:H7 GN=efeU PE=1 SV=3 12 310 2.0E-08
sp|Q8FJ36|EFEU_ECOL6 Ferrous iron permease EfeU OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=efeU PE=1 SV=2 12 312 3.0E-08
sp|P75901|EFEU_ECOLI Putative inactive ferrous iron permease EfeU OS=Escherichia coli (strain K12) GN=efeU PE=5 SV=2 12 310 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005381 iron ion transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0034755 iron ion transmembrane transport Yes
GO:0033573 high-affinity iron permease complex Yes
GO:0098797 plasma membrane protein complex No
GO:0005215 transporter activity No
GO:0034220 ion transmembrane transport No
GO:1990204 oxidoreductase complex No
GO:0003674 molecular_function No
GO:1905862 ferroxidase complex No
GO:0051179 localization No
GO:0006810 transport No
GO:1902494 catalytic complex No
GO:0000041 transition metal ion transport No
GO:0098662 inorganic cation transmembrane transport No
GO:0051234 establishment of localization No
GO:0046915 transition metal ion transmembrane transporter activity No
GO:0032991 protein-containing complex No
GO:0098655 cation transmembrane transport No
GO:0008150 biological_process No
GO:0098660 inorganic ion transmembrane transport No
GO:0098796 membrane protein complex No
GO:0022857 transmembrane transporter activity No
GO:1990351 transporter complex No
GO:1902495 transmembrane transporter complex No
GO:0006826 iron ion transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0006811 ion transport No
GO:0006812 cation transport No
GO:0055085 transmembrane transport No
GO:0008324 cation transmembrane transporter activity No
GO:0046873 metal ion transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0030001 metal ion transport No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0015075 ion transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 11 33 22
2 54 76 22
3 91 113 22
4 147 169 22
5 179 198 19
6 210 232 22
7 291 313 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6615
MAATDVFSIPVFLIVFRETLETVIIVSILLAFLKQTLDGPGSHVQAYRALRRQIWIGVGAGFLLCMIIAGAVIGV
WYTLRLNSWEANENYYEGAFCLVASIIITVMGAALLRIGNMQDKWRLKVAQAIETPVKTGSRRWWARLPEKYAMF
FLPFITVLREGVEAVVFTAGVSFTAPASAVPLPVVVGLGLGILVGWLLYKGASTAKLQLFLVLSTCLLYLVAAGL
FSRGVWHLETQEWNIAVGGDAAETGSGPGSYDIDRSVWHVNCCSPTGPSAGGWGIFNAIFGWQNSATYGSVISYN
MYWIAVITAFVVMRFRETKGHWPLFSPKSLASPNISSHGSENGAGVVESKHPAQEKTTAVSA
Coding >Ophio5|6615
ATGGCCGCCACCGACGTCTTCTCCATCCCCGTCTTCCTCATCGTCTTCCGCGAGACGCTCGAGACCGTCATCATC
GTCTCCATCCTCCTCGCCTTTCTCAAGCAGACGCTTGATGGGCCCGGCAGTCATGTTCAGGCCTACCGCGCTCTG
AGGCGCCAGATCTGGATCGGCGTCGGCGCCGGCTTCCTCCTCTGCATGATCATTGCCGGCGCCGTCATCGGTGTC
TGGTACACGCTGCGTCTCAACTCGTGGGAGGCAAACGAAAACTACTACGAGGGCGCCTTTTGCCTCGTCGCCTCC
ATCATCATCACCGTCATGGGCGCCGCCCTCCTTCGCATTGGTAACATGCAGGACAAGTGGCGTCTCAAGGTTGCT
CAGGCCATCGAGACTCCCGTCAAGACCGGCTCGCGTCGCTGGTGGGCTCGTCTGCCTGAGAAATACGCCATGTTT
TTCCTCCCCTTCATCACCGTTCTTCGCGAGGGAGTCGAGGCTGTCGTCTTCACTGCCGGCGTCTCGTTCACGGCA
CCGGCCTCTGCTGTGCCTCTGCCCGTTGTCGTCGGCCTCGGTCTCGGCATCCTCGTCGGTTGGCTCTTGTACAAG
GGGGCGTCCACCGCCAAGCTGCAACTGTTCCTCGTCCTCTCAACATGCCTGCTGTATCTCGTCGCCGCCGGCCTT
TTCTCCCGAGGCGTCTGGCACCTCGAGACCCAAGAGTGGAACATTGCCGTCGGCGGCGATGCTGCCGAGACCGGC
AGCGGTCCAGGTTCCTACGACATCGACAGAAGCGTGTGGCATGTCAACTGCTGCTCGCCGACGGGGCCCAGTGCC
GGCGGCTGGGGCATCTTCAACGCCATCTTTGGCTGGCAGAACTCGGCCACGTACGGCTCCGTCATCTCCTACAAC
ATGTACTGGATCGCCGTCATCACCGCCTTCGTCGTCATGCGCTTCCGCGAGACCAAGGGCCACTGGCCACTGTTC
AGCCCCAAGTCTCTTGCGTCTCCCAACATCTCCTCTCATGGGAGCGAGAACGGGGCCGGCGTTGTCGAGTCCAAG
CATCCGGCACAGGAGAAGACGACAGCCGTGTCGGCG
Transcript >Ophio5|6615
ATGGCCGCCACCGACGTCTTCTCCATCCCCGTCTTCCTCATCGTCTTCCGCGAGACGCTCGAGACCGTCATCATC
GTCTCCATCCTCCTCGCCTTTCTCAAGCAGACGCTTGATGGGCCCGGCAGTCATGTTCAGGCCTACCGCGCTCTG
AGGCGCCAGATCTGGATCGGCGTCGGCGCCGGCTTCCTCCTCTGCATGATCATTGCCGGCGCCGTCATCGGTGTC
TGGTACACGCTGCGTCTCAACTCGTGGGAGGCAAACGAAAACTACTACGAGGGCGCCTTTTGCCTCGTCGCCTCC
ATCATCATCACCGTCATGGGCGCCGCCCTCCTTCGCATTGGTAACATGCAGGACAAGTGGCGTCTCAAGGTTGCT
CAGGCCATCGAGACTCCCGTCAAGACCGGCTCGCGTCGCTGGTGGGCTCGTCTGCCTGAGAAATACGCCATGTTT
TTCCTCCCCTTCATCACCGTTCTTCGCGAGGGAGTCGAGGCTGTCGTCTTCACTGCCGGCGTCTCGTTCACGGCA
CCGGCCTCTGCTGTGCCTCTGCCCGTTGTCGTCGGCCTCGGTCTCGGCATCCTCGTCGGTTGGCTCTTGTACAAG
GGGGCGTCCACCGCCAAGCTGCAACTGTTCCTCGTCCTCTCAACATGCCTGCTGTATCTCGTCGCCGCCGGCCTT
TTCTCCCGAGGCGTCTGGCACCTCGAGACCCAAGAGTGGAACATTGCCGTCGGCGGCGATGCTGCCGAGACCGGC
AGCGGTCCAGGTTCCTACGACATCGACAGAAGCGTGTGGCATGTCAACTGCTGCTCGCCGACGGGGCCCAGTGCC
GGCGGCTGGGGCATCTTCAACGCCATCTTTGGCTGGCAGAACTCGGCCACGTACGGCTCCGTCATCTCCTACAAC
ATGTACTGGATCGCCGTCATCACCGCCTTCGTCGTCATGCGCTTCCGCGAGACCAAGGGCCACTGGCCACTGTTC
AGCCCCAAGTCTCTTGCGTCTCCCAACATCTCCTCTCATGGGAGCGAGAACGGGGCCGGCGTTGTCGAGTCCAAG
CATCCGGCACAGGAGAAGACGACAGCCGTGTCGGCGTGA
Gene >Ophio5|6615
ATGGCCGCCACCGACGTCTTCTCCATCCCCGTCTTCCTCATCGTCTTCCGCGAGACGCTCGAGACCGTCATCATC
GTCTCCATCCTCCTCGCCTTTCTCAAGCAGACGCTTGATGGGCCCGGCAGTCATGTTCAGGCCTACCGCGCTCTG
AGGCGCCAGGTGACCATGGTCCCCCCTTTCTTTTCCCCTTGACCCCTCATCGTTGTTGACTCGGACTTCAGATCT
GGATCGGCGTCGGCGCCGGCTTCCTCCTCTGCATGATCATTGCCGGCGCCGTCATCGGTGTCTGGTACACGCTGC
GTCTCAACTCGTGGGAGGCAAACGAAAACTACTACGAGGGCGCCTTTTGCCTCGTCGCCTCCATCATCATCACCG
TCATGGGCGCCGCCCTCCTTCGCATTGGTAACATGCAGGACAAGTGGCGTCTCAAGGTTGCTCAGGCCATCGAGA
CTCCCGTCAAGACCGGCTCGCGTCGCTGGTGGGCTCGTCTGCCTGAGAAATACGCCATGTTTTTCCTCCCCTTCA
TCACCGTTCTTCGCGAGGGAGTCGAGGCTGTCGTCTTCACTGCCGGCGTCTCGTTCACGGCACCGGCCTCTGCTG
TGCCTCTGCCCGTTGTCGTCGGCCTCGGTCTCGGCATCCTCGTCGGTTGGCTCTTGTACAAGTGCGTACTTCATG
CGTCGACCCATGGCTGTGCCGTCTGCTGATGATGCGCCGCAAAAAGGGGGGCGTCCACCGCCAAGCTGCAACTGT
TCCTCGTCCTCTCAACATGCCTGCTGTATCTCGTCGCCGCCGGCCTTTTCTCCCGAGGCGTCTGGCACCTCGAGA
CCCAAGAGTGGAACATTGCCGTCGGCGGCGATGCTGCCGAGACCGGCAGCGGTCCAGGTTCCTACGACATCGACA
GAAGCGTGTGGCATGTCAACGTAAGTCGAGCTGCCATGTCCATTCCCGCCCAGTATTGACTCCTGCCAGTGCTGC
TCGCCGACGGGGCCCAGTGCCGGCGGCTGGGGCATCTTCAACGCCATCTTTGGCTGGCAGAACTCGGCCACGTAC
GGCTCCGTCATCTCCTACAACATGTACTGGATCGCCGTCATCACCGCCTTCGTCGTCATGCGCTTCCGCGAGACC
AAGGGCCACTGGCCACTGTTCAGCCCCAAGTCTCTTGCGTCTCCCAACATCTCCTCTCATGGGAGCGAGAACGGG
GCCGGCGTTGTCGAGTCCAAGCATCCGGCACAGGAGAAGACGACAGCCGTGTCGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail