Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6610
Gene name
Locationscaffold_59:20054..21359
Strand+
Gene length (bp)1305
Transcript length (bp)1305
Coding sequence length (bp)1302
Protein length (aa) 434

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11754 Velvet Velvet factor 6.9E-18 220 289
PF11754 Velvet Velvet factor 3.3E-30 294 399

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2705 0.9539 0.063 0.0224 0.0951 0.0011 0.0541 0.024 0.0083 0.0125

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2412
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1777
Ophiocordyceps australis map64 (Brazil) OphauB2|5164
Ophiocordyceps camponoti-floridani Ophcf2|06514
Ophiocordyceps camponoti-rufipedis Ophun1|5611
Ophiocordyceps kimflemingae Ophio5|6610 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3415

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6610
MESRPSEDMSVPCDEDTGLSQSHGPRPHHSHNPQRHHPPVAHALAPRDSQRLPPPDSFLVGASSSTPGHRLHLHY
PPSPPRAAAAPALLRPPPPMAALSEPQLKTIPPLPSLSPPTLAGLQASSPQRGPDAWKPAPTVAAGPDGSPPPQF
ARGTSFPPRPQGADSYRDGPRLSGHRSIQPPPLSTPRARQVAAAADGTSAPTMPNLLAPGRTQALGDMRFSLRMR
QQPRAARACGFGDRDRRVIDPPPIVQLVIESGSMTEDEVQSYLRCESYVMNCAICDETGTRDASFMPDDYQHQRR
LMGSLVGTPFVGRDDKGVEGCFFCFGDLSCRTPGAFRLKFTLIMIDPMRAGIIRHFPILTEALSDVFYVYSAKEF
PGMLPSSNLAKRLKEQGCIISIKKGNDRSRGSRQPRDDASDNEDADVGQSPRRRRLARD
Coding >Ophio5|6610
ATGGAGTCGAGGCCCTCTGAAGACATGTCTGTTCCCTGCGACGAGGATACGGGCCTGTCCCAGTCACACGGTCCT
CGTCCTCACCACAGTCATAACCCCCAACGTCATCACCCTCCCGTCGCTCATGCCTTGGCCCCGCGAGACTCCCAA
CGGCTGCCACCCCCCGACAGCTTCCTCGTCGGAGCGTCGAGCTCGACGCCCGGCCATCGCCTTCACCTTCATTAC
CCGCCGTCCCCTCCCCGAGCAGCTGCTGCCCCTGCTCTTCTTCGTCCCCCCCCACCCATGGCCGCCTTGTCCGAA
CCCCAGCTGAAGACGATCCCGCCCTTGCCATCACTGTCGCCGCCCACCTTGGCCGGCTTGCAGGCTTCGTCGCCG
CAGCGCGGCCCGGACGCCTGGAAACCGGCTCCGACCGTCGCGGCCGGGCCCGACGGCTCGCCGCCGCCACAGTTC
GCCCGGGGGACGTCCTTCCCGCCCCGCCCGCAGGGAGCCGACTCGTACCGTGACGGCCCTCGCCTCTCGGGACAT
CGGTCGATCCAACCGCCGCCGCTGTCGACCCCTCGGGCTCGGCAGGTGGCCGCCGCAGCTGACGGGACGTCTGCG
CCGACGATGCCGAACCTTTTGGCTCCCGGTCGGACGCAGGCTTTGGGTGACATGCGCTTCAGCCTCAGGATGCGG
CAGCAGCCCCGCGCGGCACGGGCCTGCGGGTTCGGCGACCGGGACAGGCGCGTCATCGACCCGCCGCCCATCGTG
CAGCTCGTCATCGAGAGCGGCAGCATGACGGAAGACGAGGTGCAATCGTACCTCCGCTGCGAGAGCTACGTCATG
AACTGCGCCATCTGCGACGAGACGGGCACCCGCGACGCCTCCTTCATGCCCGACGACTACCAGCACCAGCGCCGT
CTGATGGGCTCCCTCGTCGGCACCCCCTTCGTCGGCCGGGATGACAAGGGAGTCGAGGGGTGCTTCTTTTGCTTC
GGTGATCTCTCGTGCCGCACGCCGGGCGCGTTCCGGCTCAAGTTTACGCTCATCATGATCGACCCGATGCGCGCC
GGCATCATCCGGCACTTCCCCATCCTGACGGAGGCGCTGAGCGACGTCTTCTACGTCTACAGCGCCAAGGAGTTC
CCCGGAATGCTTCCCAGTAGCAACCTGGCGAAACGGCTCAAGGAGCAGGGCTGTATCATCTCCATCAAGAAGGGG
AACGACCGCTCGAGGGGTTCTCGACAGCCTCGGGATGACGCGTCCGATAACGAGGACGCCGACGTTGGCCAGAGC
CCGCGGAGGCGGCGCCTGGCTCGGGAC
Transcript >Ophio5|6610
ATGGAGTCGAGGCCCTCTGAAGACATGTCTGTTCCCTGCGACGAGGATACGGGCCTGTCCCAGTCACACGGTCCT
CGTCCTCACCACAGTCATAACCCCCAACGTCATCACCCTCCCGTCGCTCATGCCTTGGCCCCGCGAGACTCCCAA
CGGCTGCCACCCCCCGACAGCTTCCTCGTCGGAGCGTCGAGCTCGACGCCCGGCCATCGCCTTCACCTTCATTAC
CCGCCGTCCCCTCCCCGAGCAGCTGCTGCCCCTGCTCTTCTTCGTCCCCCCCCACCCATGGCCGCCTTGTCCGAA
CCCCAGCTGAAGACGATCCCGCCCTTGCCATCACTGTCGCCGCCCACCTTGGCCGGCTTGCAGGCTTCGTCGCCG
CAGCGCGGCCCGGACGCCTGGAAACCGGCTCCGACCGTCGCGGCCGGGCCCGACGGCTCGCCGCCGCCACAGTTC
GCCCGGGGGACGTCCTTCCCGCCCCGCCCGCAGGGAGCCGACTCGTACCGTGACGGCCCTCGCCTCTCGGGACAT
CGGTCGATCCAACCGCCGCCGCTGTCGACCCCTCGGGCTCGGCAGGTGGCCGCCGCAGCTGACGGGACGTCTGCG
CCGACGATGCCGAACCTTTTGGCTCCCGGTCGGACGCAGGCTTTGGGTGACATGCGCTTCAGCCTCAGGATGCGG
CAGCAGCCCCGCGCGGCACGGGCCTGCGGGTTCGGCGACCGGGACAGGCGCGTCATCGACCCGCCGCCCATCGTG
CAGCTCGTCATCGAGAGCGGCAGCATGACGGAAGACGAGGTGCAATCGTACCTCCGCTGCGAGAGCTACGTCATG
AACTGCGCCATCTGCGACGAGACGGGCACCCGCGACGCCTCCTTCATGCCCGACGACTACCAGCACCAGCGCCGT
CTGATGGGCTCCCTCGTCGGCACCCCCTTCGTCGGCCGGGATGACAAGGGAGTCGAGGGGTGCTTCTTTTGCTTC
GGTGATCTCTCGTGCCGCACGCCGGGCGCGTTCCGGCTCAAGTTTACGCTCATCATGATCGACCCGATGCGCGCC
GGCATCATCCGGCACTTCCCCATCCTGACGGAGGCGCTGAGCGACGTCTTCTACGTCTACAGCGCCAAGGAGTTC
CCCGGAATGCTTCCCAGTAGCAACCTGGCGAAACGGCTCAAGGAGCAGGGCTGTATCATCTCCATCAAGAAGGGG
AACGACCGCTCGAGGGGTTCTCGACAGCCTCGGGATGACGCGTCCGATAACGAGGACGCCGACGTTGGCCAGAGC
CCGCGGAGGCGGCGCCTGGCTCGGGACTAG
Gene >Ophio5|6610
ATGGAGTCGAGGCCCTCTGAAGACATGTCTGTTCCCTGCGACGAGGATACGGGCCTGTCCCAGTCACACGGTCCT
CGTCCTCACCACAGTCATAACCCCCAACGTCATCACCCTCCCGTCGCTCATGCCTTGGCCCCGCGAGACTCCCAA
CGGCTGCCACCCCCCGACAGCTTCCTCGTCGGAGCGTCGAGCTCGACGCCCGGCCATCGCCTTCACCTTCATTAC
CCGCCGTCCCCTCCCCGAGCAGCTGCTGCCCCTGCTCTTCTTCGTCCCCCCCCACCCATGGCCGCCTTGTCCGAA
CCCCAGCTGAAGACGATCCCGCCCTTGCCATCACTGTCGCCGCCCACCTTGGCCGGCTTGCAGGCTTCGTCGCCG
CAGCGCGGCCCGGACGCCTGGAAACCGGCTCCGACCGTCGCGGCCGGGCCCGACGGCTCGCCGCCGCCACAGTTC
GCCCGGGGGACGTCCTTCCCGCCCCGCCCGCAGGGAGCCGACTCGTACCGTGACGGCCCTCGCCTCTCGGGACAT
CGGTCGATCCAACCGCCGCCGCTGTCGACCCCTCGGGCTCGGCAGGTGGCCGCCGCAGCTGACGGGACGTCTGCG
CCGACGATGCCGAACCTTTTGGCTCCCGGTCGGACGCAGGCTTTGGGTGACATGCGCTTCAGCCTCAGGATGCGG
CAGCAGCCCCGCGCGGCACGGGCCTGCGGGTTCGGCGACCGGGACAGGCGCGTCATCGACCCGCCGCCCATCGTG
CAGCTCGTCATCGAGAGCGGCAGCATGACGGAAGACGAGGTGCAATCGTACCTCCGCTGCGAGAGCTACGTCATG
AACTGCGCCATCTGCGACGAGACGGGCACCCGCGACGCCTCCTTCATGCCCGACGACTACCAGCACCAGCGCCGT
CTGATGGGCTCCCTCGTCGGCACCCCCTTCGTCGGCCGGGATGACAAGGGAGTCGAGGGGTGCTTCTTTTGCTTC
GGTGATCTCTCGTGCCGCACGCCGGGCGCGTTCCGGCTCAAGTTTACGCTCATCATGATCGACCCGATGCGCGCC
GGCATCATCCGGCACTTCCCCATCCTGACGGAGGCGCTGAGCGACGTCTTCTACGTCTACAGCGCCAAGGAGTTC
CCCGGAATGCTTCCCAGTAGCAACCTGGCGAAACGGCTCAAGGAGCAGGGCTGTATCATCTCCATCAAGAAGGGG
AACGACCGCTCGAGGGGTTCTCGACAGCCTCGGGATGACGCGTCCGATAACGAGGACGCCGACGTTGGCCAGAGC
CCGCGGAGGCGGCGCCTGGCTCGGGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail