Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6607
Gene name
Locationscaffold_59:7276..8170
Strand-
Gene length (bp)894
Transcript length (bp)894
Coding sequence length (bp)891
Protein length (aa) 297

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06682 SARAF SOCE-associated regulatory factor of calcium homoeostasis 6.7E-91 5 297

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0IHF9|SARAF_XENLA Store-operated calcium entry-associated regulatory factor OS=Xenopus laevis GN=saraf PE=2 SV=2 1 297 1.0E-22
sp|Q08E24|SARAF_BOVIN Store-operated calcium entry-associated regulatory factor OS=Bos taurus GN=SARAF PE=2 SV=1 19 297 1.0E-22
sp|F1QPC3|SARAF_DANRE Store-operated calcium entry-associated regulatory factor OS=Danio rerio GN=saraf PE=2 SV=1 21 132 3.0E-22
sp|Q6AYN2|SARAF_RAT Store-operated calcium entry-associated regulatory factor OS=Rattus norvegicus GN=Saraf PE=2 SV=1 13 243 2.0E-21
sp|Q96BY9|SARAF_HUMAN Store-operated calcium entry-associated regulatory factor OS=Homo sapiens GN=SARAF PE=1 SV=1 13 169 2.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0IHF9|SARAF_XENLA Store-operated calcium entry-associated regulatory factor OS=Xenopus laevis GN=saraf PE=2 SV=2 1 297 1.0E-22
sp|Q08E24|SARAF_BOVIN Store-operated calcium entry-associated regulatory factor OS=Bos taurus GN=SARAF PE=2 SV=1 19 297 1.0E-22
sp|F1QPC3|SARAF_DANRE Store-operated calcium entry-associated regulatory factor OS=Danio rerio GN=saraf PE=2 SV=1 21 132 3.0E-22
sp|Q6AYN2|SARAF_RAT Store-operated calcium entry-associated regulatory factor OS=Rattus norvegicus GN=Saraf PE=2 SV=1 13 243 2.0E-21
sp|Q96BY9|SARAF_HUMAN Store-operated calcium entry-associated regulatory factor OS=Homo sapiens GN=SARAF PE=1 SV=1 13 169 2.0E-21
sp|Q54P59|SARAF_DICDI Store-operated calcium entry-associated regulatory factor OS=Dictyostelium discoideum GN=saraf PE=3 SV=1 1 167 3.0E-21
sp|Q8R3Q0|SARAF_MOUSE Store-operated calcium entry-associated regulatory factor OS=Mus musculus GN=Saraf PE=1 SV=2 13 243 4.0E-21
sp|Q5R491|SARAF_PONAB Store-operated calcium entry-associated regulatory factor OS=Pongo abelii GN=SARAF PE=2 SV=2 13 132 6.0E-21
sp|F7C1E2|SARAF_XENTR Store-operated calcium entry-associated regulatory factor OS=Xenopus tropicalis GN=saraf PE=3 SV=2 19 132 2.0E-18
[Show less]

GO

GO Term Description Terminal node
GO:0030176 integral component of endoplasmic reticulum membrane Yes
GO:2001256 regulation of store-operated calcium entry Yes
GO:0110165 cellular anatomical entity No
GO:0051924 regulation of calcium ion transport No
GO:0008150 biological_process No
GO:0032879 regulation of localization No
GO:0043269 regulation of ion transport No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0031301 integral component of organelle membrane No
GO:0065007 biological regulation No
GO:0010959 regulation of metal ion transport No
GO:0050789 regulation of biological process No
GO:0031227 intrinsic component of endoplasmic reticulum membrane No
GO:0031300 intrinsic component of organelle membrane No
GO:0016021 integral component of membrane No
GO:0051049 regulation of transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 146 168 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6607
MLLFALALFLSLALAARPQNAILLSDVRTLTLRGHGAKTTHRRLPAVPQLQCLSGRLCDLYPLDRMRCTNQGSSY
GPEDVEWTCSASLPEEFKLGSTDVVCEGYNSADDPYVLKGSCAVEYRLLLTAKGEERYPHMAGSSSHSIDWSAWL
FAAVFVAISVWILYSACFANNGGRRLRAAAGHRRGGGGGGGGGGGGWNPGWGPPPDDPPPPYPGSKPYSTRQQGW
TPGFWSGLLGGAAAGYMAGGRRRDDSARRGPYSANWGAGPYSSWSSSPPSSSSEAGPSRLQESTGFGSTRRR
Coding >Ophio5|6607
ATGCTTCTCTTCGCCCTCGCATTATTCCTCTCCCTCGCCCTCGCCGCCCGACCCCAAAACGCCATCCTCCTCTCC
GACGTCCGCACTCTGACCCTTCGCGGCCATGGCGCCAAGACAACCCATCGCCGCCTGCCCGCCGTACCTCAGCTG
CAGTGCCTCTCCGGCCGGCTATGCGACTTGTATCCCCTCGACCGCATGCGCTGTACCAATCAGGGCTCCTCGTAC
GGCCCCGAAGACGTCGAGTGGACCTGTTCCGCTTCTCTACCCGAAGAATTCAAGCTCGGCAGCACAGACGTCGTC
TGTGAGGGCTATAACTCTGCTGATGATCCCTACGTTCTCAAGGGCAGTTGTGCCGTCGAGTATCGCCTGCTCTTG
ACAGCCAAGGGCGAGGAACGATACCCGCACATGGCCGGGTCATCGAGTCACTCCATCGACTGGTCTGCCTGGCTC
TTTGCCGCGGTCTTCGTCGCCATTTCAGTCTGGATCCTCTATTCTGCCTGCTTCGCTAATAATGGCGGTAGGCGA
CTCCGCGCCGCCGCTGGCCACCGCCGTGGTGGTGGAGGGGGAGGAGGAGGAGGGGGCGGTGGATGGAACCCGGGC
TGGGGTCCGCCGCCGGACGATCCTCCGCCGCCGTATCCCGGATCAAAGCCCTACTCGACCCGCCAACAGGGCTGG
ACCCCGGGCTTCTGGTCCGGCCTCCTGGGCGGTGCCGCGGCTGGCTACATGGCTGGCGGTCGCCGTCGGGACGAC
AGCGCCAGACGAGGCCCCTACTCCGCCAACTGGGGCGCGGGACCCTACAGCTCCTGGTCCTCCTCCCCTCCCTCT
TCGAGCTCGGAAGCCGGACCAAGTCGTCTTCAAGAAAGCACCGGTTTCGGCTCGACCCGTCGCAGA
Transcript >Ophio5|6607
ATGCTTCTCTTCGCCCTCGCATTATTCCTCTCCCTCGCCCTCGCCGCCCGACCCCAAAACGCCATCCTCCTCTCC
GACGTCCGCACTCTGACCCTTCGCGGCCATGGCGCCAAGACAACCCATCGCCGCCTGCCCGCCGTACCTCAGCTG
CAGTGCCTCTCCGGCCGGCTATGCGACTTGTATCCCCTCGACCGCATGCGCTGTACCAATCAGGGCTCCTCGTAC
GGCCCCGAAGACGTCGAGTGGACCTGTTCCGCTTCTCTACCCGAAGAATTCAAGCTCGGCAGCACAGACGTCGTC
TGTGAGGGCTATAACTCTGCTGATGATCCCTACGTTCTCAAGGGCAGTTGTGCCGTCGAGTATCGCCTGCTCTTG
ACAGCCAAGGGCGAGGAACGATACCCGCACATGGCCGGGTCATCGAGTCACTCCATCGACTGGTCTGCCTGGCTC
TTTGCCGCGGTCTTCGTCGCCATTTCAGTCTGGATCCTCTATTCTGCCTGCTTCGCTAATAATGGCGGTAGGCGA
CTCCGCGCCGCCGCTGGCCACCGCCGTGGTGGTGGAGGGGGAGGAGGAGGAGGGGGCGGTGGATGGAACCCGGGC
TGGGGTCCGCCGCCGGACGATCCTCCGCCGCCGTATCCCGGATCAAAGCCCTACTCGACCCGCCAACAGGGCTGG
ACCCCGGGCTTCTGGTCCGGCCTCCTGGGCGGTGCCGCGGCTGGCTACATGGCTGGCGGTCGCCGTCGGGACGAC
AGCGCCAGACGAGGCCCCTACTCCGCCAACTGGGGCGCGGGACCCTACAGCTCCTGGTCCTCCTCCCCTCCCTCT
TCGAGCTCGGAAGCCGGACCAAGTCGTCTTCAAGAAAGCACCGGTTTCGGCTCGACCCGTCGCAGATAG
Gene >Ophio5|6607
ATGCTTCTCTTCGCCCTCGCATTATTCCTCTCCCTCGCCCTCGCCGCCCGACCCCAAAACGCCATCCTCCTCTCC
GACGTCCGCACTCTGACCCTTCGCGGCCATGGCGCCAAGACAACCCATCGCCGCCTGCCCGCCGTACCTCAGCTG
CAGTGCCTCTCCGGCCGGCTATGCGACTTGTATCCCCTCGACCGCATGCGCTGTACCAATCAGGGCTCCTCGTAC
GGCCCCGAAGACGTCGAGTGGACCTGTTCCGCTTCTCTACCCGAAGAATTCAAGCTCGGCAGCACAGACGTCGTC
TGTGAGGGCTATAACTCTGCTGATGATCCCTACGTTCTCAAGGGCAGTTGTGCCGTCGAGTATCGCCTGCTCTTG
ACAGCCAAGGGCGAGGAACGATACCCGCACATGGCCGGGTCATCGAGTCACTCCATCGACTGGTCTGCCTGGCTC
TTTGCCGCGGTCTTCGTCGCCATTTCAGTCTGGATCCTCTATTCTGCCTGCTTCGCTAATAATGGCGGTAGGCGA
CTCCGCGCCGCCGCTGGCCACCGCCGTGGTGGTGGAGGGGGAGGAGGAGGAGGGGGCGGTGGATGGAACCCGGGC
TGGGGTCCGCCGCCGGACGATCCTCCGCCGCCGTATCCCGGATCAAAGCCCTACTCGACCCGCCAACAGGGCTGG
ACCCCGGGCTTCTGGTCCGGCCTCCTGGGCGGTGCCGCGGCTGGCTACATGGCTGGCGGTCGCCGTCGGGACGAC
AGCGCCAGACGAGGCCCCTACTCCGCCAACTGGGGCGCGGGACCCTACAGCTCCTGGTCCTCCTCCCCTCCCTCT
TCGAGCTCGGAAGCCGGACCAAGTCGTCTTCAAGAAAGCACCGGTTTCGGCTCGACCCGTCGCAGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail