Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6590
Gene name
Locationscaffold_587:2707..4438
Strand+
Gene length (bp)1731
Transcript length (bp)1665
Coding sequence length (bp)1662
Protein length (aa) 554

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.4E-39 63 450
PF00083 Sugar_tr Sugar (and other) transporter 5.2E-17 85 256
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 3.4E-07 53 238

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 41 497 1.0E-84
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 41 497 2.0E-84
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 36 495 4.0E-81
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 38 497 4.0E-80
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 30 496 3.0E-75
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 41 497 1.0E-84
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 41 497 2.0E-84
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 36 495 4.0E-81
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 38 497 4.0E-80
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 30 496 3.0E-75
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 41 495 2.0E-74
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 4 495 1.0E-70
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 41 499 1.0E-69
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 36 493 3.0E-68
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 15 495 2.0E-67
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 36 493 2.0E-66
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 42 497 2.0E-62
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 5 494 2.0E-60
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 26 497 7.0E-58
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 41 497 8.0E-58
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 43 495 4.0E-57
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 31 497 1.0E-56
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 1 494 5.0E-55
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 43 497 2.0E-51
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 43 497 2.0E-51
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 41 514 7.0E-49
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 16 497 1.0E-44
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 43 500 1.0E-42
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 47 500 2.0E-42
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 47 500 2.0E-41
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 2 512 1.0E-40
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 43 500 2.0E-36
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 5 501 1.0E-32
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 48 263 9.0E-19
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 51 267 4.0E-15
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 80 234 3.0E-14
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 82 511 4.0E-12
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 365 500 9.0E-12
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 7 239 9.0E-11
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 5 234 2.0E-10
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 53 218 1.0E-09
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 15 239 1.0E-09
sp|B0JZE1|SPNS2_XENTR Protein spinster homolog 2 OS=Xenopus tropicalis GN=spns2 PE=2 SV=1 76 250 3.0E-09
sp|Q9CCP7|MFS55_MYCLE MFS-type drug efflux transporter P55 OS=Mycobacterium leprae (strain TN) GN=ML0556 PE=3 SV=1 98 254 4.0E-09
sp|Q797E3|PBUE_BACSU Purine efflux pump PbuE OS=Bacillus subtilis (strain 168) GN=pbuE PE=1 SV=1 76 228 4.0E-09
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 101 229 5.0E-09
sp|Q9GQQ0|SPIN_DROME Protein spinster OS=Drosophila melanogaster GN=spin PE=1 SV=1 76 343 8.0E-09
sp|Q0GQS6|PBUE_BACAM Purine efflux pump PbuE OS=Bacillus amyloliquefaciens GN=pbuE PE=1 SV=1 76 214 3.0E-08
sp|A5WM93|MFS55_MYCTF MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain F11) GN=TBFG_11439 PE=3 SV=1 98 245 5.0E-08
sp|Q7U042|MFS55_MYCBO MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1445c PE=3 SV=1 98 245 5.0E-08
sp|A1KIJ9|MFS55_MYCBP MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_1471c PE=1 SV=1 98 245 5.0E-08
sp|C1AN55|MFS55_MYCBT MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=JTY_1446 PE=3 SV=1 98 245 5.0E-08
sp|A5U2B2|MFS55_MYCTA MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_1419 PE=3 SV=1 98 245 5.0E-08
sp|C6DTH3|MFS55_MYCTK MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain KZN 1435 / MDR) GN=TBMG_02570 PE=3 SV=1 98 245 5.0E-08
sp|P9WJY2|MFS55_MYCTO MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1454 PE=3 SV=1 98 245 5.0E-08
sp|P9WJY3|MFS55_MYCTU MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1410c PE=1 SV=1 98 245 5.0E-08
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 53 338 2.0E-07
sp|P39637|YWFA_BACSU Uncharacterized MFS-type transporter YwfA OS=Bacillus subtilis (strain 168) GN=ywfA PE=3 SV=1 66 301 3.0E-07
sp|Q5XGK0|SPNS1_XENLA Protein spinster homolog 1 OS=Xenopus laevis GN=spns1 PE=2 SV=1 53 246 4.0E-07
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 55 294 6.0E-07
sp|P76628|YGAY_ECOLI Putative uncharacterized transporter YgaY OS=Escherichia coli (strain K12) GN=ygaY PE=5 SV=2 80 241 8.0E-07
sp|Q8X4V6|YGAY_ECO57 Uncharacterized transporter YgaY OS=Escherichia coli O157:H7 GN=ygaY PE=3 SV=1 80 241 9.0E-07
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 71 421 1.0E-06
sp|P37498|YYBF_BACSU Uncharacterized MFS-type transporter YybF OS=Bacillus subtilis (strain 168) GN=yybF PE=3 SV=1 62 211 1.0E-06
sp|Q7ZU13|SPNS1_DANRE Protein spinster homolog 1 OS=Danio rerio GN=spns1 PE=2 SV=1 53 233 2.0E-06
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 51 217 2.0E-06
sp|Q7Z118|YMPB_CAEEL Putative transporter B0361.11 OS=Caenorhabditis elegans GN=B0361.11 PE=3 SV=2 98 268 2.0E-06
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 45 218 3.0E-06
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 29 250 3.0E-06
sp|A2CER7|SPNS3_DANRE Protein spinster homolog 3 OS=Danio rerio GN=spns3 PE=2 SV=1 42 217 3.0E-06
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 45 218 3.0E-06
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 39 230 4.0E-06
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 2 218 5.0E-06
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 67 218 5.0E-06
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 67 218 6.0E-06
sp|Q9I6Q3|PCAK_PSEAE 4-hydroxybenzoate transporter PcaK OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pcaK PE=3 SV=1 39 207 6.0E-06
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 51 215 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.5

Transmembrane Domains

Domain # Start End Length
1 56 78 22
2 93 115 22
3 128 150 22
4 181 203 22
5 210 232 22
6 288 310 22
7 323 345 22
8 369 391 22
9 398 420 22
10 462 484 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6590
MDQVETQTEDKVPVPQAVEARAGTSEDGVYINSEGYVDFAPGDPGFPQNWPMKRRIIVTSCVVFLVFNATFASSA
ISGCFPSLIKHFHISTVVAGLSVTVFLLGYCAGPLFFAPLSEIYGRRWIFYSTFTLYFAFNFLCAFAPNYAALLI
GRAITGTLVSAPLSNAPGVIADVWNPIERGTAMAGFAASVWCGSALGPVVGGFLQLKEDWRWVFYVQIWLAAGSL
LLMILIPETHAPTILRQRAERLRKSGTPGTENVKAPADDTDRSLGPALKVAVTRPWVILFDPISFFCAVYLSVIY
TLLYMLFAIYPFIFQRKRGWNAGVSKLPLLGTIVGCFFGAGLIVLETQKRAKRVKRGEVKPEDFEAEDRLPLAMG
GGIGFAISMFAFAWTGEFNSVPWIVPTIAGGILSCCLLLVFVAFLNYIVDSYLQFAASAIAANTIARSACGSAAP
LFTLQMFKALGVGVGGSVIGGVAIVLSAIPFLFYRYGKGIRARSKFSPAKAKAAKKGPDEELAVMTAYDAYAKSM
EGLVDADGRPHHVDPWRNDSFSGEWPLRQ
Coding >Ophio5|6590
ATGGATCAGGTCGAAACCCAAACAGAAGACAAGGTCCCGGTTCCTCAGGCAGTCGAAGCGAGAGCCGGGACCAGC
GAAGATGGCGTTTACATCAACAGCGAAGGCTACGTCGACTTTGCGCCTGGCGATCCTGGTTTCCCCCAAAATTGG
CCCATGAAGAGGCGGATTATCGTCACATCCTGCGTTGTGTTTCTTGTCTTCAACGCTACCTTTGCCTCGAGCGCC
ATCAGCGGCTGTTTTCCCTCTCTGATCAAGCACTTTCACATCTCCACCGTCGTCGCTGGTCTCTCCGTCACCGTC
TTCCTCCTTGGTTACTGCGCAGGGCCCCTGTTCTTTGCGCCATTGAGCGAAATCTACGGCCGGCGGTGGATTTTC
TATAGCACCTTTACTCTCTATTTCGCCTTCAACTTCCTATGCGCCTTTGCGCCCAACTACGCGGCCCTATTGATC
GGCAGAGCCATCACCGGTACTCTCGTCTCGGCGCCGCTCAGCAACGCTCCCGGTGTCATTGCTGATGTCTGGAAC
CCCATCGAGAGAGGCACTGCCATGGCCGGATTCGCGGCGTCGGTTTGGTGCGGATCCGCCCTAGGGCCTGTTGTC
GGTGGCTTCCTGCAGCTCAAAGAGGACTGGCGATGGGTATTTTATGTGCAGATCTGGCTCGCAGCCGGGTCCCTA
CTGCTCATGATCTTGATACCCGAAACGCATGCCCCGACGATTCTGCGGCAGAGGGCGGAGCGGCTTCGAAAGTCG
GGCACCCCTGGAACGGAGAACGTCAAGGCGCCGGCCGATGATACGGATCGATCACTCGGCCCTGCTCTCAAGGTC
GCCGTCACCCGGCCCTGGGTCATTCTGTTCGATCCCATCTCGTTTTTCTGCGCCGTCTACTTGTCCGTCATCTAC
ACGCTGCTCTATATGCTGTTCGCCATTTACCCCTTCATCTTTCAGCGCAAGCGAGGGTGGAACGCAGGCGTCAGC
AAGTTGCCGTTGCTGGGAACTATTGTCGGTTGCTTCTTTGGTGCTGGCCTCATCGTGCTCGAAACGCAGAAGCGT
GCCAAGAGGGTCAAGCGAGGGGAGGTCAAGCCAGAAGACTTTGAAGCTGAGGACCGGCTTCCGCTTGCCATGGGG
GGCGGTATCGGCTTCGCCATATCCATGTTTGCTTTCGCCTGGACTGGAGAGTTCAACTCGGTCCCATGGATCGTC
CCCACCATCGCGGGCGGCATTCTTTCGTGCTGTCTGCTCCTCGTTTTCGTAGCATTCCTCAACTACATTGTCGAC
AGTTATCTGCAGTTCGCGGCCTCGGCCATCGCTGCCAATACCATTGCTCGATCGGCGTGTGGTTCTGCGGCGCCT
CTGTTTACGCTTCAGATGTTCAAGGCACTTGGCGTCGGCGTCGGAGGCAGCGTCATCGGAGGCGTCGCTATTGTG
CTGTCCGCTATCCCTTTTCTATTTTACCGGTACGGGAAAGGCATCCGGGCACGAAGCAAGTTCTCGCCAGCCAAG
GCCAAGGCGGCGAAGAAAGGACCTGATGAGGAGTTGGCGGTGATGACGGCCTACGATGCGTACGCCAAGTCGATG
GAGGGCCTTGTCGACGCTGACGGCAGGCCTCACCATGTCGATCCGTGGCGTAACGATAGCTTCAGTGGCGAGTGG
CCTCTAAGACAG
Transcript >Ophio5|6590
ATGGATCAGGTCGAAACCCAAACAGAAGACAAGGTCCCGGTTCCTCAGGCAGTCGAAGCGAGAGCCGGGACCAGC
GAAGATGGCGTTTACATCAACAGCGAAGGCTACGTCGACTTTGCGCCTGGCGATCCTGGTTTCCCCCAAAATTGG
CCCATGAAGAGGCGGATTATCGTCACATCCTGCGTTGTGTTTCTTGTCTTCAACGCTACCTTTGCCTCGAGCGCC
ATCAGCGGCTGTTTTCCCTCTCTGATCAAGCACTTTCACATCTCCACCGTCGTCGCTGGTCTCTCCGTCACCGTC
TTCCTCCTTGGTTACTGCGCAGGGCCCCTGTTCTTTGCGCCATTGAGCGAAATCTACGGCCGGCGGTGGATTTTC
TATAGCACCTTTACTCTCTATTTCGCCTTCAACTTCCTATGCGCCTTTGCGCCCAACTACGCGGCCCTATTGATC
GGCAGAGCCATCACCGGTACTCTCGTCTCGGCGCCGCTCAGCAACGCTCCCGGTGTCATTGCTGATGTCTGGAAC
CCCATCGAGAGAGGCACTGCCATGGCCGGATTCGCGGCGTCGGTTTGGTGCGGATCCGCCCTAGGGCCTGTTGTC
GGTGGCTTCCTGCAGCTCAAAGAGGACTGGCGATGGGTATTTTATGTGCAGATCTGGCTCGCAGCCGGGTCCCTA
CTGCTCATGATCTTGATACCCGAAACGCATGCCCCGACGATTCTGCGGCAGAGGGCGGAGCGGCTTCGAAAGTCG
GGCACCCCTGGAACGGAGAACGTCAAGGCGCCGGCCGATGATACGGATCGATCACTCGGCCCTGCTCTCAAGGTC
GCCGTCACCCGGCCCTGGGTCATTCTGTTCGATCCCATCTCGTTTTTCTGCGCCGTCTACTTGTCCGTCATCTAC
ACGCTGCTCTATATGCTGTTCGCCATTTACCCCTTCATCTTTCAGCGCAAGCGAGGGTGGAACGCAGGCGTCAGC
AAGTTGCCGTTGCTGGGAACTATTGTCGGTTGCTTCTTTGGTGCTGGCCTCATCGTGCTCGAAACGCAGAAGCGT
GCCAAGAGGGTCAAGCGAGGGGAGGTCAAGCCAGAAGACTTTGAAGCTGAGGACCGGCTTCCGCTTGCCATGGGG
GGCGGTATCGGCTTCGCCATATCCATGTTTGCTTTCGCCTGGACTGGAGAGTTCAACTCGGTCCCATGGATCGTC
CCCACCATCGCGGGCGGCATTCTTTCGTGCTGTCTGCTCCTCGTTTTCGTAGCATTCCTCAACTACATTGTCGAC
AGTTATCTGCAGTTCGCGGCCTCGGCCATCGCTGCCAATACCATTGCTCGATCGGCGTGTGGTTCTGCGGCGCCT
CTGTTTACGCTTCAGATGTTCAAGGCACTTGGCGTCGGCGTCGGAGGCAGCGTCATCGGAGGCGTCGCTATTGTG
CTGTCCGCTATCCCTTTTCTATTTTACCGGTACGGGAAAGGCATCCGGGCACGAAGCAAGTTCTCGCCAGCCAAG
GCCAAGGCGGCGAAGAAAGGACCTGATGAGGAGTTGGCGGTGATGACGGCCTACGATGCGTACGCCAAGTCGATG
GAGGGCCTTGTCGACGCTGACGGCAGGCCTCACCATGTCGATCCGTGGCGTAACGATAGCTTCAGTGGCGAGTGG
CCTCTAAGACAGTAA
Gene >Ophio5|6590
ATGGATCAGGTCGAAACCCAAACAGAAGACAAGGTCCCGGTTCCTCAGGCAGTCGAAGCGAGAGCCGGGACCAGC
GAAGATGGCGTTTACATCAACAGCGAAGGCTACGTCGACTTTGCGCCTGGCGATCCTGGTTTCCCCCAAAATTGG
CCCATGAAGAGGCGGATTATCGTCACATCCTGCGTTGTGTTTCTTGTCTTCAACGCTACCTTTGCCTCGAGCGCC
ATCAGCGGCTGTTTTCCCTCTCTGATCAAGCACTTTCACATCTCCACCGTCGTCGCTGGTCTCTCCGTCACCGTC
TTCCTCCTTGGTTACTGCGCAGGGCCCCTGTTCTTTGCGCCATTGAGCGAAATCTACGGCCGGCGGTGGATTTTC
TATAGCACCTTTACTCTCTATTTCGCCTTCAACTTCCTATGCGCCTTTGCGCCCAACTACGCGGCCCTATTGATC
GGCAGAGCCATCACCGGTACTCTCGTCTCGGCGCCGCTCAGCAACGCTCCCGGTGTCATTGCTGATGTCTGGAAC
CCCATCGAGAGAGGCACTGCCATGGCCGGATTCGCGGCGTCGGTTTGGTGCGGATCCGCCCTAGGGCCTGTTGTC
GGTGGCTTCCTGCAGCTCAAAGAGGACTGGCGATGGGTATTTTATGTGCAGATCTGGCTCGCAGCCGGGTCCCTA
CTGCTCATGATCTTGATACCCGAAACGCATGCCCCGACGATTCTGCGGCAGAGGGCGGAGCGGCTTCGAAAGTCG
GGCACCCCTGGAACGGAGAACGTCAAGGCGCCGGCCGATGATACGGATCGATCACTCGGCCCTGCTCTCAAGGTC
GCCGTCACCCGGCCCTGGGTCATTCTGTTCGATCCCATCTCGTTTTTCTGCGCCGTCTACTTGTCCGTCATCTAC
ACGCTGCTCTATATGCTGTTCGCCATTTACCCCTTCATCTTTCAGCGCAAGCGAGGGTGGAACGCAGGCGTCAGC
AAGTTGCCGTTGCTGGGAACTATTGTCGGTTGCTTCTTTGGTGCTGGCCTCATCGTGCTCGAAACGCAGAAGCGT
GCCAAGAGGGTCAAGCGAGGGGAGGTCAAGCCAGAAGACTTTGAAGCTGAGGACCGGCTTCCGCTTGCCATGGGG
GGCGGTATCGGCTTCGCCATATCCATGTTTGCTTTCGCCTGGACTGGAGAGTTCAAGTAAGTTCGCCCCAATCGG
AGGGATATGACGGTTGAAAGAGGGCGTAAGGCTAATATGGAGATAAGCTCGGTCCCATGGATCGTCCCCACCATC
GCGGGCGGCATTCTTTCGTGCTGTCTGCTCCTCGTTTTCGTAGCATTCCTCAACTACATTGTCGACAGTTATCTG
CAGTTCGCGGCCTCGGCCATCGCTGCCAATACCATTGCTCGATCGGCGTGTGGTTCTGCGGCGCCTCTGTTTACG
CTTCAGATGTTCAAGGCACTTGGCGTCGGCGTCGGAGGCAGCGTCATCGGAGGCGTCGCTATTGTGCTGTCCGCT
ATCCCTTTTCTATTTTACCGGTACGGGAAAGGCATCCGGGCACGAAGCAAGTTCTCGCCAGCCAAGGCCAAGGCG
GCGAAGAAAGGACCTGATGAGGAGTTGGCGGTGATGACGGCCTACGATGCGTACGCCAAGTCGATGGAGGGCCTT
GTCGACGCTGACGGCAGGCCTCACCATGTCGATCCGTGGCGTAACGATAGCTTCAGTGGCGAGTGGCCTCTAAGA
CAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail