Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6574
Gene name
Locationscaffold_584:2480..2861
Strand+
Gene length (bp)381
Transcript length (bp)381
Coding sequence length (bp)378
Protein length (aa) 126

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B2H3|ALL7_ARTBC Allergen Asp f 7 homolog OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02701 PE=3 SV=1 27 111 2.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 15.21 2.94 27.48
CcL In ants, during behavior modification 1.75 0.00 4.46
CcD In ants, recently dead 0.62 0.00 2.11

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.015267 yes
SC16a CcD 0.159128 no
CcL CcD 0.382390 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6574
MPSLLSLSLSLSLSLTLILTTLTPTLCSSLKEKTGDVTWYEPGLGACGETSLKEDAIVAVSPSYFDRHDACSRKL
RVTYHGASLDLRVVDRCAGCAVNDLDLSPSAFKHLVGDLGVGRVAAVWEWI
Coding >Ophio5|6574
ATGCCCTCCCTCCTCAGCCTCAGCCTCAGCCTCAGCCTCAGCCTCACCCTCATCCTCACCACCCTCACCCCCACC
CTCTGCTCCTCGCTGAAGGAGAAAACCGGCGACGTGACATGGTACGAGCCCGGCCTCGGCGCCTGCGGCGAAACC
AGCCTCAAGGAAGACGCCATCGTTGCCGTCTCGCCCAGTTACTTCGATCGCCATGACGCTTGCAGCCGTAAGCTC
CGCGTCACCTACCACGGCGCCAGTCTCGACCTCCGCGTCGTCGACCGATGCGCTGGTTGTGCCGTCAACGACCTC
GACCTCTCGCCTTCGGCTTTCAAGCACCTCGTCGGTGATCTCGGCGTTGGACGTGTAGCCGCTGTTTGGGAGTGG
ATT
Transcript >Ophio5|6574
ATGCCCTCCCTCCTCAGCCTCAGCCTCAGCCTCAGCCTCAGCCTCACCCTCATCCTCACCACCCTCACCCCCACC
CTCTGCTCCTCGCTGAAGGAGAAAACCGGCGACGTGACATGGTACGAGCCCGGCCTCGGCGCCTGCGGCGAAACC
AGCCTCAAGGAAGACGCCATCGTTGCCGTCTCGCCCAGTTACTTCGATCGCCATGACGCTTGCAGCCGTAAGCTC
CGCGTCACCTACCACGGCGCCAGTCTCGACCTCCGCGTCGTCGACCGATGCGCTGGTTGTGCCGTCAACGACCTC
GACCTCTCGCCTTCGGCTTTCAAGCACCTCGTCGGTGATCTCGGCGTTGGACGTGTAGCCGCTGTTTGGGAGTGG
ATTTAG
Gene >Ophio5|6574
ATGCCCTCCCTCCTCAGCCTCAGCCTCAGCCTCAGCCTCAGCCTCACCCTCATCCTCACCACCCTCACCCCCACC
CTCTGCTCCTCGCTGAAGGAGAAAACCGGCGACGTGACATGGTACGAGCCCGGCCTCGGCGCCTGCGGCGAAACC
AGCCTCAAGGAAGACGCCATCGTTGCCGTCTCGCCCAGTTACTTCGATCGCCATGACGCTTGCAGCCGTAAGCTC
CGCGTCACCTACCACGGCGCCAGTCTCGACCTCCGCGTCGTCGACCGATGCGCTGGTTGTGCCGTCAACGACCTC
GACCTCTCGCCTTCGGCTTTCAAGCACCTCGTCGGTGATCTCGGCGTTGGACGTGTAGCCGCTGTTTGGGAGTGG
ATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail