Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6566
Gene name
Locationscaffold_582:2396..3239
Strand-
Gene length (bp)843
Transcript length (bp)678
Coding sequence length (bp)675
Protein length (aa) 225

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08294 TIM21 TIM21 1.2E-41 61 205

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZ95|TIM21_GIBZE Mitochondrial import inner membrane translocase subunit TIM21 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TIM21 PE=3 SV=1 2 223 1.0E-94
sp|Q7S8S5|TIM21_NEUCR Mitochondrial import inner membrane translocase subunit tim21 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tim21 PE=3 SV=1 10 223 1.0E-74
sp|Q4X1I8|TIM21_ASPFU Mitochondrial import inner membrane translocase subunit tim21 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tim21 PE=3 SV=1 21 223 2.0E-60
sp|P53220|TIM21_YEAST Mitochondrial import inner membrane translocase subunit TIM21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM21 PE=1 SV=1 65 224 3.0E-19
sp|Q6CW96|TIM21_KLULA Mitochondrial import inner membrane translocase subunit TIM21 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TIM21 PE=3 SV=1 66 224 1.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZ95|TIM21_GIBZE Mitochondrial import inner membrane translocase subunit TIM21 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TIM21 PE=3 SV=1 2 223 1.0E-94
sp|Q7S8S5|TIM21_NEUCR Mitochondrial import inner membrane translocase subunit tim21 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tim21 PE=3 SV=1 10 223 1.0E-74
sp|Q4X1I8|TIM21_ASPFU Mitochondrial import inner membrane translocase subunit tim21 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tim21 PE=3 SV=1 21 223 2.0E-60
sp|P53220|TIM21_YEAST Mitochondrial import inner membrane translocase subunit TIM21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM21 PE=1 SV=1 65 224 3.0E-19
sp|Q6CW96|TIM21_KLULA Mitochondrial import inner membrane translocase subunit TIM21 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TIM21 PE=3 SV=1 66 224 1.0E-18
sp|Q6CAQ9|TIM21_YARLI Mitochondrial import inner membrane translocase subunit TIM21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIM21 PE=3 SV=1 6 225 2.0E-18
sp|Q75CX4|TIM21_ASHGO Mitochondrial import inner membrane translocase subunit TIM21 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TIM21 PE=3 SV=1 61 224 6.0E-18
sp|O94618|TIM21_SCHPO Mitochondrial import inner membrane translocase subunit tim21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tim21 PE=3 SV=1 1 225 7.0E-16
sp|Q6FMZ2|TIM21_CANGA Mitochondrial import inner membrane translocase subunit TIM21 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TIM21 PE=3 SV=1 87 224 4.0E-13
sp|Q6BVK1|TIM21_DEBHA Mitochondrial import inner membrane translocase subunit TIM21 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TIM21 PE=3 SV=2 60 224 5.0E-13
sp|Q9BVV7|TIM21_HUMAN Mitochondrial import inner membrane translocase subunit Tim21 OS=Homo sapiens GN=TIMM21 PE=1 SV=1 74 208 5.0E-09
sp|Q3SZV6|TIM21_BOVIN Mitochondrial import inner membrane translocase subunit Tim21 OS=Bos taurus GN=TIMM21 PE=2 SV=1 56 207 2.0E-08
sp|Q5XKA2|TIM21_XENLA Mitochondrial import inner membrane translocase subunit Tim21 OS=Xenopus laevis GN=timm21 PE=2 SV=1 9 199 1.0E-06
sp|Q5U2X7|TIM21_RAT Mitochondrial import inner membrane translocase subunit Tim21 OS=Rattus norvegicus GN=Timm21 PE=2 SV=1 56 210 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005744 TIM23 mitochondrial import inner membrane translocase complex Yes
GO:0030150 protein import into mitochondrial matrix Yes
GO:1990542 mitochondrial transmembrane transport No
GO:0033036 macromolecule localization No
GO:0055085 transmembrane transport No
GO:0044743 protein transmembrane import into intracellular organelle No
GO:0051179 localization No
GO:0006810 transport No
GO:0006886 intracellular protein transport No
GO:0051234 establishment of localization No
GO:0033365 protein localization to organelle No
GO:0071705 nitrogen compound transport No
GO:0032991 protein-containing complex No
GO:0070727 cellular macromolecule localization No
GO:0098798 mitochondrial protein-containing complex No
GO:0065002 intracellular protein transmembrane transport No
GO:0008150 biological_process No
GO:0070585 protein localization to mitochondrion No
GO:0045184 establishment of protein localization No
GO:0072655 establishment of protein localization to mitochondrion No
GO:0009987 cellular process No
GO:0051641 cellular localization No
GO:0051649 establishment of localization in cell No
GO:0008104 protein localization No
GO:0072594 establishment of protein localization to organelle No
GO:0071806 protein transmembrane transport No
GO:0005575 cellular_component No
GO:0006839 mitochondrial transport No
GO:0046907 intracellular transport No
GO:0098800 inner mitochondrial membrane protein complex No
GO:0071702 organic substance transport No
GO:0098796 membrane protein complex No
GO:0015031 protein transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 69 91 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 40.88 17.76 64.00
CcL In ants, during behavior modification 67.68 32.48 102.89
CcD In ants, recently dead 43.38 19.35 67.41

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.062885 no
SC16a CcD 0.864437 no
CcL CcD 0.093940 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6566
MLRVIRSTASSSSVPLLVARRTYGSHTSLGATAAPKQRRRSITPFDDNGSVPWRELSATEKMARATQQSFNGGMI
VIGLALTGTVAYFLWTDVFSPDSKVSQFNRAVDRIKRDPRCIQLLGDAHKITAHGEETLNKWRRARPLSYSEKVD
AQGDSHLLMHFHVDGPLQNGIAQLHMVRRRGESDYGYRYFFVDVKGHERIYLDKARSEPSVGKKQLSLFGVKWGQ
Coding >Ophio5|6566
ATGCTGCGGGTGATTCGATCAACCGCCTCCTCTTCTTCCGTGCCGCTGCTCGTTGCTAGGCGGACATACGGCTCA
CATACTAGCCTTGGAGCTACGGCGGCGCCGAAGCAGAGACGGCGGAGCATCACCCCGTTCGACGACAATGGGTCG
GTGCCTTGGAGAGAACTCTCTGCGACAGAGAAGATGGCTCGGGCGACGCAGCAGAGCTTCAACGGCGGCATGATC
GTCATCGGCCTCGCGCTCACGGGCACCGTCGCTTATTTCCTCTGGACGGACGTATTCTCTCCTGATAGCAAGGTT
TCCCAATTCAACCGCGCCGTCGACCGGATCAAGAGGGACCCCAGGTGCATCCAGTTACTGGGAGACGCTCACAAG
ATCACGGCCCACGGAGAGGAGACGCTGAACAAGTGGCGGCGGGCTCGCCCTCTTTCATACTCTGAAAAGGTTGAT
GCTCAGGGGGACTCCCATCTCCTGATGCACTTTCATGTCGATGGACCGCTGCAGAACGGTATCGCGCAGCTGCAC
ATGGTTAGGCGACGGGGGGAGAGCGACTATGGGTACAGGTATTTCTTCGTGGACGTCAAGGGGCACGAGCGCATC
TATCTGGACAAGGCACGATCCGAGCCGAGCGTGGGGAAGAAGCAGCTCAGCCTCTTTGGCGTCAAATGGGGCCAG
Transcript >Ophio5|6566
ATGCTGCGGGTGATTCGATCAACCGCCTCCTCTTCTTCCGTGCCGCTGCTCGTTGCTAGGCGGACATACGGCTCA
CATACTAGCCTTGGAGCTACGGCGGCGCCGAAGCAGAGACGGCGGAGCATCACCCCGTTCGACGACAATGGGTCG
GTGCCTTGGAGAGAACTCTCTGCGACAGAGAAGATGGCTCGGGCGACGCAGCAGAGCTTCAACGGCGGCATGATC
GTCATCGGCCTCGCGCTCACGGGCACCGTCGCTTATTTCCTCTGGACGGACGTATTCTCTCCTGATAGCAAGGTT
TCCCAATTCAACCGCGCCGTCGACCGGATCAAGAGGGACCCCAGGTGCATCCAGTTACTGGGAGACGCTCACAAG
ATCACGGCCCACGGAGAGGAGACGCTGAACAAGTGGCGGCGGGCTCGCCCTCTTTCATACTCTGAAAAGGTTGAT
GCTCAGGGGGACTCCCATCTCCTGATGCACTTTCATGTCGATGGACCGCTGCAGAACGGTATCGCGCAGCTGCAC
ATGGTTAGGCGACGGGGGGAGAGCGACTATGGGTACAGGTATTTCTTCGTGGACGTCAAGGGGCACGAGCGCATC
TATCTGGACAAGGCACGATCCGAGCCGAGCGTGGGGAAGAAGCAGCTCAGCCTCTTTGGCGTCAAATGGGGCCAG
TGA
Gene >Ophio5|6566
ATGCTGCGGGTGATTCGATCAACCGCCTCCTCTTCTTCCGTGCCGCTGCTCGTTGCTAGGCGGACATACGGCTCA
CATACTAGCCTTGGAGCTACGGCGGCGCCGAAGCAGAGACGGCGGAGCATCACCCCGTTCGACGACAATGGGTCG
GTGCCTTGGAGAGAACTCTCTGCGACAGAGAAGATGGCTCGGGCGACGCAGCAGAGCTTCAACGGCGGCATGATC
GTCATCGGCCTCGCGCTCACGGTACGGCCTCGGCCTGGTCCTATGCTCGGTAAAGCAGCGCGCTGACACTGGCCA
GGGCACCGTCGCTTATTTCCTCTGGACGGACGTATTCTCTCCTGATAGCAAGGTTTCCCAATTCAACCGCGCCGT
CGACCGGATCAAGAGGGACCCCAGGTGCATCCAGTTACTGGGAGACGCTCACAAGATCACGGCCCACGGAGAGGA
GACGCTGAACAAGTGGCGGCGGGCTCGCCCTCTTTCGTGCGTTGATCTCTGGTTGGTACCTGGCCCGTGTTGTCT
GCTGACGCCTTCCCAGATACTCTGAAAAGGTTGATGCTCAGGGGGACTCCCATCTCCTGATGCACTTTCATGTGA
GTGCAGTCGCCCTGGCAGGCGCTCAGACGAAGCACTGACGACGACGGCTAGGTCGATGGACCGCTGCAGAACGGT
ATCGCGCAGCTGCACATGGTTAGGCGACGGGGGGAGAGCGACTATGGGTACAGGTATTTCTTCGTGGACGTCAAG
GGGCACGAGCGCATCTATCTGGACAAGGCACGATCCGAGCCGAGCGTGGGGAAGAAGCAGCTCAGCCTCTTTGGC
GTCAAATGGGGCCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail