Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6560
Gene name
Locationscaffold_580:6675..8086
Strand-
Gene length (bp)1411
Transcript length (bp)1278
Coding sequence length (bp)1275
Protein length (aa) 425

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06728 PIG-U GPI transamidase subunit PIG-U 4.0E-124 12 390

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9H490|PIGU_HUMAN Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Homo sapiens GN=PIGU PE=1 SV=3 26 410 1.0E-71
sp|Q8CHJ1|PIGU_RAT Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Rattus norvegicus GN=Pigu PE=1 SV=3 26 410 2.0E-71
sp|Q8K358|PIGU_MOUSE Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Mus musculus GN=Pigu PE=1 SV=4 26 410 1.0E-70
sp|Q8CHJ0|PIGU_CRIGR Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Cricetulus griseus GN=PIGU PE=1 SV=3 26 410 1.0E-70
sp|P41733|CDC91_YEAST GPI transamidase component GAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAB1 PE=1 SV=1 16 425 5.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9H490|PIGU_HUMAN Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Homo sapiens GN=PIGU PE=1 SV=3 26 410 1.0E-71
sp|Q8CHJ1|PIGU_RAT Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Rattus norvegicus GN=Pigu PE=1 SV=3 26 410 2.0E-71
sp|Q8K358|PIGU_MOUSE Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Mus musculus GN=Pigu PE=1 SV=4 26 410 1.0E-70
sp|Q8CHJ0|PIGU_CRIGR Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Cricetulus griseus GN=PIGU PE=1 SV=3 26 410 1.0E-70
sp|P41733|CDC91_YEAST GPI transamidase component GAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAB1 PE=1 SV=1 16 425 5.0E-58
sp|O13883|PIGU_SCHPO GPI transamidase component GAB1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1952.01 PE=3 SV=2 29 425 1.0E-54
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 7 24 17
2 85 107 22
3 128 150 22
4 177 199 22
5 220 242 22
6 280 302 22
7 309 331 22
8 351 373 22
9 380 398 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 57.92 31.86 83.99
CcL In ants, during behavior modification 90.98 46.40 135.56
CcD In ants, recently dead 87.12 47.65 126.58

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.061231 no
SC16a CcD 0.075303 no
CcL CcD 0.881379 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6560
MTLRGKAGVYAAAALLRLVLTLVFPGLPDLLTGRVEISTPMTSFKRLQEGLFLYNHNVSPYDGGVYHQAPLLLPL
FSLLPDAKRWPIFTTVLYILVDILCADALVSIADSGEAGQSRLFTSPRRARRASGLFVAAAFLFNPFTIATCIAR
STNVFTSCAILHAIARAVRGSPFSALVALSFAAYLSMSPLLLLPPLVLLAWDRRPERRGGGGGSPSVADFAAKCV
LTVAACLAVLVAMSLVVTGNSSDFLARTYGIQLTLTDLTPNVGLWWYFFIEMFDSFRAFFLAVFWLHLSSYVGGL
TIRFRSQPLVVLTLLLGILAIFKPYPCIADTSLFLAMLPLFWHLFPLMRYTFVASATILYATFLGPAFYHLWIYA
GSGNANFFYAITLVWSLGQSLLVSDLAFAVIRDEWEVDRPEMVGKDVKQI
Coding >Ophio5|6560
ATGACCCTGCGAGGCAAGGCCGGCGTCTACGCCGCCGCGGCCCTCTTGCGACTCGTTCTGACGCTCGTCTTTCCG
GGCCTGCCTGACCTACTGACCGGCCGCGTCGAGATCTCGACGCCCATGACGAGCTTCAAGCGACTTCAGGAAGGC
TTGTTTCTTTACAATCACAACGTCTCGCCCTACGATGGCGGAGTCTATCATCAGGCGCCTCTGCTCCTCCCGCTC
TTCTCGCTGCTCCCCGACGCCAAGCGCTGGCCCATCTTCACCACGGTGCTATACATCCTGGTCGATATCCTCTGC
GCTGATGCCCTGGTGAGCATTGCCGACTCGGGTGAGGCCGGCCAGTCGCGGCTCTTTACGTCGCCTCGCCGCGCC
CGTCGCGCATCCGGTCTCTTTGTCGCCGCCGCCTTCCTGTTCAACCCCTTCACCATCGCCACGTGCATTGCCCGC
TCCACAAACGTCTTCACCTCGTGCGCCATCCTCCACGCCATCGCCAGGGCCGTCCGCGGCTCGCCCTTCAGCGCC
CTCGTGGCCCTCTCCTTCGCCGCCTATCTTTCCATGTCTCCGCTGCTGCTCCTCCCGCCACTCGTCCTCCTGGCC
TGGGATCGACGTCCCGAGAGGCGCGGCGGCGGCGGCGGCTCGCCGTCCGTCGCCGACTTCGCCGCCAAGTGCGTC
CTCACCGTGGCCGCCTGTCTCGCCGTCCTCGTGGCCATGTCTCTCGTCGTCACCGGCAACTCGTCCGACTTCTTG
GCCCGTACCTATGGCATTCAGCTCACGCTCACGGACCTGACGCCCAACGTCGGACTCTGGTGGTACTTCTTCATC
GAGATGTTCGACTCCTTTCGCGCCTTTTTCCTCGCCGTCTTCTGGCTGCATTTGTCGTCGTACGTCGGCGGCCTC
ACCATCCGCTTCCGCTCACAGCCCCTCGTCGTCCTCACCCTCCTGCTCGGCATCCTCGCCATCTTCAAACCTTAC
CCCTGCATCGCCGACACCAGCCTCTTCCTGGCCATGCTGCCGCTCTTCTGGCACTTATTTCCCCTCATGCGCTAC
ACTTTTGTCGCCTCCGCCACCATACTGTATGCCACCTTTCTCGGCCCGGCCTTTTACCACCTCTGGATCTACGCC
GGCAGCGGCAACGCAAACTTTTTTTACGCCATCACCTTGGTTTGGAGTCTGGGCCAGAGTCTGCTCGTGTCCGAT
CTGGCTTTCGCCGTCATCAGAGATGAGTGGGAGGTGGACAGGCCTGAAATGGTGGGAAAGGATGTGAAGCAGATC
Transcript >Ophio5|6560
ATGACCCTGCGAGGCAAGGCCGGCGTCTACGCCGCCGCGGCCCTCTTGCGACTCGTTCTGACGCTCGTCTTTCCG
GGCCTGCCTGACCTACTGACCGGCCGCGTCGAGATCTCGACGCCCATGACGAGCTTCAAGCGACTTCAGGAAGGC
TTGTTTCTTTACAATCACAACGTCTCGCCCTACGATGGCGGAGTCTATCATCAGGCGCCTCTGCTCCTCCCGCTC
TTCTCGCTGCTCCCCGACGCCAAGCGCTGGCCCATCTTCACCACGGTGCTATACATCCTGGTCGATATCCTCTGC
GCTGATGCCCTGGTGAGCATTGCCGACTCGGGTGAGGCCGGCCAGTCGCGGCTCTTTACGTCGCCTCGCCGCGCC
CGTCGCGCATCCGGTCTCTTTGTCGCCGCCGCCTTCCTGTTCAACCCCTTCACCATCGCCACGTGCATTGCCCGC
TCCACAAACGTCTTCACCTCGTGCGCCATCCTCCACGCCATCGCCAGGGCCGTCCGCGGCTCGCCCTTCAGCGCC
CTCGTGGCCCTCTCCTTCGCCGCCTATCTTTCCATGTCTCCGCTGCTGCTCCTCCCGCCACTCGTCCTCCTGGCC
TGGGATCGACGTCCCGAGAGGCGCGGCGGCGGCGGCGGCTCGCCGTCCGTCGCCGACTTCGCCGCCAAGTGCGTC
CTCACCGTGGCCGCCTGTCTCGCCGTCCTCGTGGCCATGTCTCTCGTCGTCACCGGCAACTCGTCCGACTTCTTG
GCCCGTACCTATGGCATTCAGCTCACGCTCACGGACCTGACGCCCAACGTCGGACTCTGGTGGTACTTCTTCATC
GAGATGTTCGACTCCTTTCGCGCCTTTTTCCTCGCCGTCTTCTGGCTGCATTTGTCGTCGTACGTCGGCGGCCTC
ACCATCCGCTTCCGCTCACAGCCCCTCGTCGTCCTCACCCTCCTGCTCGGCATCCTCGCCATCTTCAAACCTTAC
CCCTGCATCGCCGACACCAGCCTCTTCCTGGCCATGCTGCCGCTCTTCTGGCACTTATTTCCCCTCATGCGCTAC
ACTTTTGTCGCCTCCGCCACCATACTGTATGCCACCTTTCTCGGCCCGGCCTTTTACCACCTCTGGATCTACGCC
GGCAGCGGCAACGCAAACTTTTTTTACGCCATCACCTTGGTTTGGAGTCTGGGCCAGAGTCTGCTCGTGTCCGAT
CTGGCTTTCGCCGTCATCAGAGATGAGTGGGAGGTGGACAGGCCTGAAATGGTGGGAAAGGATGTGAAGCAGATC
TAG
Gene >Ophio5|6560
ATGACCCTGCGAGGCAAGGCCGGCGTCTACGCCGCCGCGGCCCTCTTGCGACTCGTTCTGACGCTCGTCTTTCCG
GGCCTGCCTGACCTACTGACCGGCCGCGTCGAGATCTCGACGCCCATGACGAGCTTCAAGCGACGTGAGGCCTCC
CCTCCTCTTCCTGATCATTCCTCGCTGAAACACGCTCTAGTTCAGGAAGGCTTGTTTCTTTACAATCACAACGTC
TCGCCCTACGATGGCGGAGTCTATCATCAGGCGCCTCTGCTCCTCCCGCTCTTCTCGCTGCTCCCCGACGCCAAG
CGCTGGCCCATCTTCACCACGGTGCTATACATCCTGGTCGATATCCTCTGCGCTGATGCCCTGGTGAGCATTGCC
GACTCGGGTGAGGCCGGCCAGTCGCGGCTCTTTACGTCGCCTCGCCGCGCCCGTCGCGCATCCGGTCTCTTTGTC
GCCGCCGCGTGAGTCCTTTGCTTCCCCCCACCCGGGCATCATGCCTCCTTGATCCCTCAGGCTGAACGCATTAAA
AAAAAAAAAAAAAAGCTTCCTGTTCAACCCCTTCACCATCGCCACGTGCATTGCCCGCTCCACAAACGTCTTCAC
CTCGTGCGCCATCCTCCACGCCATCGCCAGGGCCGTCCGCGGCTCGCCCTTCAGCGCCCTCGTGGCCCTCTCCTT
CGCCGCCTATCTTTCCATGTCTCCGCTGCTGCTCCTCCCGCCACTCGTCCTCCTGGCCTGGGATCGACGTCCCGA
GAGGCGCGGCGGCGGCGGCGGCTCGCCGTCCGTCGCCGACTTCGCCGCCAAGTGCGTCCTCACCGTGGCCGCCTG
TCTCGCCGTCCTCGTGGCCATGTCTCTCGTCGTCACCGGCAACTCGTCCGACTTCTTGGCCCGTACCTATGGCAT
TCAGCTCACGCTCACGGACCTGACGCCCAACGTCGGACTCTGGTGGTACTTCTTCATCGAGATGTTCGACTCCTT
TCGCGCCTTTTTCCTCGCCGTCTTCTGGCTGCATTTGTCGTCGTACGTCGGCGGCCTCACCATCCGCTTCCGCTC
ACAGCCCCTCGTCGTCCTCACCCTCCTGCTCGGCATCCTCGCCATCTTCAAACCTTACCCCTGCATCGCCGACAC
CAGCCTCTTCCTGGCCATGCTGCCGCTCTTCTGGCACTTATTTCCCCTCATGCGCTACACTTTTGTCGCCTCCGC
CACCATACTGTATGCCACCTTTCTCGGCCCGGCCTTTTACCACCTCTGGATCTACGCCGGCAGCGGCAACGCAAA
CTTTTTTTACGCCATCACCTTGGTTTGGAGTCTGGGCCAGAGTCTGCTCGTGTCCGATCTGGCTTTCGCCGTCAT
CAGAGATGAGTGGGAGGTGGACAGGCCTGAAATGGTGGGAAAGGATGTGAAGCAGATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail