Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6560
Gene name
Locationscaffold_580:6675..8086
Strand-
Gene length (bp)1411
Transcript length (bp)1278
Coding sequence length (bp)1275
Protein length (aa) 425

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06728 PIG-U GPI transamidase subunit PIG-U 4.0E-124 12 390

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9H490|PIGU_HUMAN Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Homo sapiens GN=PIGU PE=1 SV=3 26 410 1.0E-71
sp|Q8CHJ1|PIGU_RAT Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Rattus norvegicus GN=Pigu PE=1 SV=3 26 410 2.0E-71
sp|Q8K358|PIGU_MOUSE Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Mus musculus GN=Pigu PE=1 SV=4 26 410 1.0E-70
sp|Q8CHJ0|PIGU_CRIGR Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Cricetulus griseus GN=PIGU PE=1 SV=3 26 410 1.0E-70
sp|P41733|CDC91_YEAST GPI transamidase component GAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAB1 PE=1 SV=1 16 425 5.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9H490|PIGU_HUMAN Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Homo sapiens GN=PIGU PE=1 SV=3 26 410 1.0E-71
sp|Q8CHJ1|PIGU_RAT Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Rattus norvegicus GN=Pigu PE=1 SV=3 26 410 2.0E-71
sp|Q8K358|PIGU_MOUSE Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Mus musculus GN=Pigu PE=1 SV=4 26 410 1.0E-70
sp|Q8CHJ0|PIGU_CRIGR Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Cricetulus griseus GN=PIGU PE=1 SV=3 26 410 1.0E-70
sp|P41733|CDC91_YEAST GPI transamidase component GAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAB1 PE=1 SV=1 16 425 5.0E-58
sp|O13883|PIGU_SCHPO GPI transamidase component GAB1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1952.01 PE=3 SV=2 29 425 1.0E-54
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 7 24 17
2 85 107 22
3 128 150 22
4 177 199 22
5 220 242 22
6 280 302 22
7 309 331 22
8 351 373 22
9 380 398 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6560
MTLRGKAGVYAAAALLRLVLTLVFPGLPDLLTGRVEISTPMTSFKRLQEGLFLYNHNVSPYDGGVYHQAPLLLPL
FSLLPDAKRWPIFTTVLYILVDILCADALVSIADSGEAGQSRLFTSPRRARRASGLFVAAAFLFNPFTIATCIAR
STNVFTSCAILHAIARAVRGSPFSALVALSFAAYLSMSPLLLLPPLVLLAWDRRPERRGGGGGSPSVADFAAKCV
LTVAACLAVLVAMSLVVTGNSSDFLARTYGIQLTLTDLTPNVGLWWYFFIEMFDSFRAFFLAVFWLHLSSYVGGL
TIRFRSQPLVVLTLLLGILAIFKPYPCIADTSLFLAMLPLFWHLFPLMRYTFVASATILYATFLGPAFYHLWIYA
GSGNANFFYAITLVWSLGQSLLVSDLAFAVIRDEWEVDRPEMVGKDVKQI
Coding >Ophio5|6560
ATGACCCTGCGAGGCAAGGCCGGCGTCTACGCCGCCGCGGCCCTCTTGCGACTCGTTCTGACGCTCGTCTTTCCG
GGCCTGCCTGACCTACTGACCGGCCGCGTCGAGATCTCGACGCCCATGACGAGCTTCAAGCGACTTCAGGAAGGC
TTGTTTCTTTACAATCACAACGTCTCGCCCTACGATGGCGGAGTCTATCATCAGGCGCCTCTGCTCCTCCCGCTC
TTCTCGCTGCTCCCCGACGCCAAGCGCTGGCCCATCTTCACCACGGTGCTATACATCCTGGTCGATATCCTCTGC
GCTGATGCCCTGGTGAGCATTGCCGACTCGGGTGAGGCCGGCCAGTCGCGGCTCTTTACGTCGCCTCGCCGCGCC
CGTCGCGCATCCGGTCTCTTTGTCGCCGCCGCCTTCCTGTTCAACCCCTTCACCATCGCCACGTGCATTGCCCGC
TCCACAAACGTCTTCACCTCGTGCGCCATCCTCCACGCCATCGCCAGGGCCGTCCGCGGCTCGCCCTTCAGCGCC
CTCGTGGCCCTCTCCTTCGCCGCCTATCTTTCCATGTCTCCGCTGCTGCTCCTCCCGCCACTCGTCCTCCTGGCC
TGGGATCGACGTCCCGAGAGGCGCGGCGGCGGCGGCGGCTCGCCGTCCGTCGCCGACTTCGCCGCCAAGTGCGTC
CTCACCGTGGCCGCCTGTCTCGCCGTCCTCGTGGCCATGTCTCTCGTCGTCACCGGCAACTCGTCCGACTTCTTG
GCCCGTACCTATGGCATTCAGCTCACGCTCACGGACCTGACGCCCAACGTCGGACTCTGGTGGTACTTCTTCATC
GAGATGTTCGACTCCTTTCGCGCCTTTTTCCTCGCCGTCTTCTGGCTGCATTTGTCGTCGTACGTCGGCGGCCTC
ACCATCCGCTTCCGCTCACAGCCCCTCGTCGTCCTCACCCTCCTGCTCGGCATCCTCGCCATCTTCAAACCTTAC
CCCTGCATCGCCGACACCAGCCTCTTCCTGGCCATGCTGCCGCTCTTCTGGCACTTATTTCCCCTCATGCGCTAC
ACTTTTGTCGCCTCCGCCACCATACTGTATGCCACCTTTCTCGGCCCGGCCTTTTACCACCTCTGGATCTACGCC
GGCAGCGGCAACGCAAACTTTTTTTACGCCATCACCTTGGTTTGGAGTCTGGGCCAGAGTCTGCTCGTGTCCGAT
CTGGCTTTCGCCGTCATCAGAGATGAGTGGGAGGTGGACAGGCCTGAAATGGTGGGAAAGGATGTGAAGCAGATC
Transcript >Ophio5|6560
ATGACCCTGCGAGGCAAGGCCGGCGTCTACGCCGCCGCGGCCCTCTTGCGACTCGTTCTGACGCTCGTCTTTCCG
GGCCTGCCTGACCTACTGACCGGCCGCGTCGAGATCTCGACGCCCATGACGAGCTTCAAGCGACTTCAGGAAGGC
TTGTTTCTTTACAATCACAACGTCTCGCCCTACGATGGCGGAGTCTATCATCAGGCGCCTCTGCTCCTCCCGCTC
TTCTCGCTGCTCCCCGACGCCAAGCGCTGGCCCATCTTCACCACGGTGCTATACATCCTGGTCGATATCCTCTGC
GCTGATGCCCTGGTGAGCATTGCCGACTCGGGTGAGGCCGGCCAGTCGCGGCTCTTTACGTCGCCTCGCCGCGCC
CGTCGCGCATCCGGTCTCTTTGTCGCCGCCGCCTTCCTGTTCAACCCCTTCACCATCGCCACGTGCATTGCCCGC
TCCACAAACGTCTTCACCTCGTGCGCCATCCTCCACGCCATCGCCAGGGCCGTCCGCGGCTCGCCCTTCAGCGCC
CTCGTGGCCCTCTCCTTCGCCGCCTATCTTTCCATGTCTCCGCTGCTGCTCCTCCCGCCACTCGTCCTCCTGGCC
TGGGATCGACGTCCCGAGAGGCGCGGCGGCGGCGGCGGCTCGCCGTCCGTCGCCGACTTCGCCGCCAAGTGCGTC
CTCACCGTGGCCGCCTGTCTCGCCGTCCTCGTGGCCATGTCTCTCGTCGTCACCGGCAACTCGTCCGACTTCTTG
GCCCGTACCTATGGCATTCAGCTCACGCTCACGGACCTGACGCCCAACGTCGGACTCTGGTGGTACTTCTTCATC
GAGATGTTCGACTCCTTTCGCGCCTTTTTCCTCGCCGTCTTCTGGCTGCATTTGTCGTCGTACGTCGGCGGCCTC
ACCATCCGCTTCCGCTCACAGCCCCTCGTCGTCCTCACCCTCCTGCTCGGCATCCTCGCCATCTTCAAACCTTAC
CCCTGCATCGCCGACACCAGCCTCTTCCTGGCCATGCTGCCGCTCTTCTGGCACTTATTTCCCCTCATGCGCTAC
ACTTTTGTCGCCTCCGCCACCATACTGTATGCCACCTTTCTCGGCCCGGCCTTTTACCACCTCTGGATCTACGCC
GGCAGCGGCAACGCAAACTTTTTTTACGCCATCACCTTGGTTTGGAGTCTGGGCCAGAGTCTGCTCGTGTCCGAT
CTGGCTTTCGCCGTCATCAGAGATGAGTGGGAGGTGGACAGGCCTGAAATGGTGGGAAAGGATGTGAAGCAGATC
TAG
Gene >Ophio5|6560
ATGACCCTGCGAGGCAAGGCCGGCGTCTACGCCGCCGCGGCCCTCTTGCGACTCGTTCTGACGCTCGTCTTTCCG
GGCCTGCCTGACCTACTGACCGGCCGCGTCGAGATCTCGACGCCCATGACGAGCTTCAAGCGACGTGAGGCCTCC
CCTCCTCTTCCTGATCATTCCTCGCTGAAACACGCTCTAGTTCAGGAAGGCTTGTTTCTTTACAATCACAACGTC
TCGCCCTACGATGGCGGAGTCTATCATCAGGCGCCTCTGCTCCTCCCGCTCTTCTCGCTGCTCCCCGACGCCAAG
CGCTGGCCCATCTTCACCACGGTGCTATACATCCTGGTCGATATCCTCTGCGCTGATGCCCTGGTGAGCATTGCC
GACTCGGGTGAGGCCGGCCAGTCGCGGCTCTTTACGTCGCCTCGCCGCGCCCGTCGCGCATCCGGTCTCTTTGTC
GCCGCCGCGTGAGTCCTTTGCTTCCCCCCACCCGGGCATCATGCCTCCTTGATCCCTCAGGCTGAACGCATTAAA
AAAAAAAAAAAAAAGCTTCCTGTTCAACCCCTTCACCATCGCCACGTGCATTGCCCGCTCCACAAACGTCTTCAC
CTCGTGCGCCATCCTCCACGCCATCGCCAGGGCCGTCCGCGGCTCGCCCTTCAGCGCCCTCGTGGCCCTCTCCTT
CGCCGCCTATCTTTCCATGTCTCCGCTGCTGCTCCTCCCGCCACTCGTCCTCCTGGCCTGGGATCGACGTCCCGA
GAGGCGCGGCGGCGGCGGCGGCTCGCCGTCCGTCGCCGACTTCGCCGCCAAGTGCGTCCTCACCGTGGCCGCCTG
TCTCGCCGTCCTCGTGGCCATGTCTCTCGTCGTCACCGGCAACTCGTCCGACTTCTTGGCCCGTACCTATGGCAT
TCAGCTCACGCTCACGGACCTGACGCCCAACGTCGGACTCTGGTGGTACTTCTTCATCGAGATGTTCGACTCCTT
TCGCGCCTTTTTCCTCGCCGTCTTCTGGCTGCATTTGTCGTCGTACGTCGGCGGCCTCACCATCCGCTTCCGCTC
ACAGCCCCTCGTCGTCCTCACCCTCCTGCTCGGCATCCTCGCCATCTTCAAACCTTACCCCTGCATCGCCGACAC
CAGCCTCTTCCTGGCCATGCTGCCGCTCTTCTGGCACTTATTTCCCCTCATGCGCTACACTTTTGTCGCCTCCGC
CACCATACTGTATGCCACCTTTCTCGGCCCGGCCTTTTACCACCTCTGGATCTACGCCGGCAGCGGCAACGCAAA
CTTTTTTTACGCCATCACCTTGGTTTGGAGTCTGGGCCAGAGTCTGCTCGTGTCCGATCTGGCTTTCGCCGTCAT
CAGAGATGAGTGGGAGGTGGACAGGCCTGAAATGGTGGGAAAGGATGTGAAGCAGATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail