Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6557
Gene name
Locationscaffold_58:50367..51053
Strand-
Gene length (bp)686
Transcript length (bp)609
Coding sequence length (bp)606
Protein length (aa) 202

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00929 RNase_T Exonuclease 3.5E-27 9 174

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P54964|ORN_YEAST Oligoribonuclease, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REX2 PE=1 SV=1 7 181 2.0E-48
sp|O94626|ORN_SCHPO Probable oligoribonuclease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rex2 PE=3 SV=2 1 180 2.0E-48
sp|A2VE52|ORN_BOVIN Oligoribonuclease, mitochondrial OS=Bos taurus GN=REXO2 PE=2 SV=1 8 184 2.0E-47
sp|A1U4D2|ORN_MARHV Oligoribonuclease OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=orn PE=3 SV=1 8 184 3.0E-47
sp|Q9KV17|ORN_VIBCH Oligoribonuclease OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=orn PE=3 SV=1 1 184 1.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P54964|ORN_YEAST Oligoribonuclease, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REX2 PE=1 SV=1 7 181 2.0E-48
sp|O94626|ORN_SCHPO Probable oligoribonuclease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rex2 PE=3 SV=2 1 180 2.0E-48
sp|A2VE52|ORN_BOVIN Oligoribonuclease, mitochondrial OS=Bos taurus GN=REXO2 PE=2 SV=1 8 184 2.0E-47
sp|A1U4D2|ORN_MARHV Oligoribonuclease OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=orn PE=3 SV=1 8 184 3.0E-47
sp|Q9KV17|ORN_VIBCH Oligoribonuclease OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=orn PE=3 SV=1 1 184 1.0E-46
sp|A5F3M7|ORN_VIBC3 Oligoribonuclease OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=orn PE=3 SV=1 1 184 1.0E-46
sp|Q9Y3B8|ORN_HUMAN Oligoribonuclease, mitochondrial OS=Homo sapiens GN=REXO2 PE=1 SV=3 8 184 1.0E-46
sp|Q5U1X1|ORN_RAT Oligoribonuclease, mitochondrial OS=Rattus norvegicus GN=Rexo2 PE=2 SV=1 8 184 3.0E-45
sp|Q9D8S4|ORN_MOUSE Oligoribonuclease, mitochondrial OS=Mus musculus GN=Rexo2 PE=1 SV=2 8 184 3.0E-45
sp|Q7NVH5|ORN_CHRVO Oligoribonuclease OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=orn PE=3 SV=1 1 181 5.0E-44
sp|Q3IG97|ORN_PSEHT Oligoribonuclease OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=orn PE=3 SV=1 1 185 1.0E-43
sp|Q7MGZ7|ORN_VIBVY Oligoribonuclease OS=Vibrio vulnificus (strain YJ016) GN=orn PE=3 SV=2 1 184 6.0E-43
sp|Q8DCV6|ORN_VIBVU Oligoribonuclease OS=Vibrio vulnificus (strain CMCP6) GN=orn PE=3 SV=2 1 184 6.0E-43
sp|Q60BD8|ORN_METCA Oligoribonuclease OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=orn PE=3 SV=1 1 184 2.0E-42
sp|Q6LM23|ORN_PHOPR Oligoribonuclease OS=Photobacterium profundum GN=orn PE=3 SV=1 1 184 2.0E-42
sp|Q9ZVE0|ORN_ARATH Oligoribonuclease OS=Arabidopsis thaliana GN=At2g26970 PE=2 SV=2 7 184 6.0E-42
sp|Q7VVH7|ORN_BORPE Oligoribonuclease OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=orn PE=3 SV=1 1 181 9.0E-42
sp|Q7W9T4|ORN_BORPA Oligoribonuclease OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=orn PE=3 SV=1 1 181 9.0E-42
sp|Q7WGX3|ORN_BORBR Oligoribonuclease OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=orn PE=3 SV=1 1 181 9.0E-42
sp|Q87L01|ORN_VIBPA Oligoribonuclease OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=orn PE=3 SV=1 1 184 2.0E-41
sp|Q5E2C2|ORN_VIBF1 Oligoribonuclease OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=orn PE=3 SV=1 1 184 2.0E-41
sp|Q5P0T5|ORN_AROAE Oligoribonuclease OS=Aromatoleum aromaticum (strain EbN1) GN=orn PE=3 SV=1 1 181 2.0E-41
sp|A7MZ48|ORN_VIBCB Oligoribonuclease OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=orn PE=3 SV=1 1 184 1.0E-40
sp|A1WTK7|ORN_HALHL Oligoribonuclease OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=orn PE=3 SV=1 1 180 1.0E-40
sp|Q6F805|ORN_ACIAD Oligoribonuclease OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=orn PE=3 SV=1 2 184 4.0E-40
sp|A1K5N0|ORN_AZOSB Oligoribonuclease OS=Azoarcus sp. (strain BH72) GN=orn PE=3 SV=1 1 181 5.0E-40
sp|Q31HZ4|ORN_THICR Oligoribonuclease OS=Thiomicrospira crunogena (strain XCL-2) GN=orn PE=3 SV=1 5 184 6.0E-40
sp|P57666|ORN_STRCO Oligoribonuclease OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=orn PE=1 SV=1 8 184 6.0E-40
sp|Q2L2P5|ORN_BORA1 Oligoribonuclease OS=Bordetella avium (strain 197N) GN=orn PE=3 SV=1 1 181 7.0E-40
sp|Q2SBB4|ORN_HAHCH Oligoribonuclease OS=Hahella chejuensis (strain KCTC 2396) GN=orn PE=3 SV=1 8 181 9.0E-40
sp|Q9VCI0|ORN_DROME Probable oligoribonuclease OS=Drosophila melanogaster GN=CG10214 PE=1 SV=1 5 184 1.0E-39
sp|Q82CS8|ORN_STRAW Oligoribonuclease OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=orn PE=3 SV=1 8 184 1.0E-39
sp|Q9JW09|ORN_NEIMA Oligoribonuclease OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=orn PE=3 SV=1 4 181 2.0E-39
sp|Q87VI6|ORN_PSESM Oligoribonuclease OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=orn PE=3 SV=1 8 181 2.0E-39
sp|Q82Y15|ORN_NITEU Oligoribonuclease OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=orn PE=3 SV=1 1 185 3.0E-39
sp|Q8Y0V1|ORN_RALSO Oligoribonuclease OS=Ralstonia solanacearum (strain GMI1000) GN=orn PE=3 SV=1 2 180 4.0E-39
sp|A1KS35|ORN_NEIMF Oligoribonuclease OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=orn PE=3 SV=1 4 181 5.0E-39
sp|Q48P10|ORN_PSE14 Oligoribonuclease OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=orn PE=3 SV=1 8 181 6.0E-39
sp|Q5FAH8|ORN_NEIG1 Oligoribonuclease OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=orn PE=3 SV=1 4 181 7.0E-39
sp|Q4ZYY8|ORN_PSEU2 Oligoribonuclease OS=Pseudomonas syringae pv. syringae (strain B728a) GN=orn PE=3 SV=1 8 181 8.0E-39
sp|P57667|ORN_STRGR Oligoribonuclease OS=Streptomyces griseus GN=orn PE=1 SV=1 8 184 1.0E-38
sp|Q0ADS5|ORN_NITEC Oligoribonuclease OS=Nitrosomonas eutropha (strain C91) GN=orn PE=3 SV=1 1 185 1.0E-38
sp|P9WIU1|ORN_MYCTU Oligoribonuclease OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=orn PE=1 SV=1 8 184 1.0E-38
sp|P9WIU0|ORN_MYCTO Oligoribonuclease OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=orn PE=3 SV=1 8 184 1.0E-38
sp|A5U5K8|ORN_MYCTA Oligoribonuclease OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=orn PE=3 SV=1 8 184 1.0E-38
sp|A1KLK6|ORN_MYCBP Oligoribonuclease OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=orn PE=3 SV=1 8 184 1.0E-38
sp|P65598|ORN_MYCBO Oligoribonuclease OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=orn PE=3 SV=1 8 184 1.0E-38
sp|Q9JXW1|ORN_NEIMB Oligoribonuclease OS=Neisseria meningitidis serogroup B (strain MC58) GN=orn PE=3 SV=1 4 181 2.0E-38
sp|Q6D037|ORN_PECAS Oligoribonuclease OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=orn PE=3 SV=1 3 181 2.0E-38
sp|Q1B5T7|ORN_MYCSS Oligoribonuclease OS=Mycobacterium sp. (strain MCS) GN=orn PE=3 SV=1 8 184 2.0E-38
sp|A1UJ99|ORN_MYCSK Oligoribonuclease OS=Mycobacterium sp. (strain KMS) GN=orn PE=3 SV=1 8 184 2.0E-38
sp|A3Q2P5|ORN_MYCSJ Oligoribonuclease OS=Mycobacterium sp. (strain JLS) GN=orn PE=3 SV=1 8 184 2.0E-38
sp|A0KSR0|ORN_SHESA Oligoribonuclease OS=Shewanella sp. (strain ANA-3) GN=orn PE=3 SV=1 1 184 2.0E-38
sp|A3QAD3|ORN_SHELP Oligoribonuclease OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=orn PE=3 SV=1 1 184 3.0E-38
sp|Q47VZ4|ORN_COLP3 Oligoribonuclease OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=orn PE=3 SV=1 1 184 4.0E-38
sp|Q65SE1|ORN_MANSM Oligoribonuclease OS=Mannheimia succiniciproducens (strain MBEL55E) GN=orn PE=3 SV=1 1 181 4.0E-38
sp|Q15Q55|ORN_PSEA6 Oligoribonuclease OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=orn PE=3 SV=1 1 185 4.0E-38
sp|A6VD64|ORN_PSEA7 Oligoribonuclease OS=Pseudomonas aeruginosa (strain PA7) GN=orn PE=3 SV=1 8 181 4.0E-38
sp|Q0SGU7|ORN_RHOJR Oligoribonuclease OS=Rhodococcus jostii (strain RHA1) GN=orn PE=3 SV=1 8 184 4.0E-38
sp|P57665|ORN_PSEAE Oligoribonuclease OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=orn PE=3 SV=1 8 181 5.0E-38
sp|Q02F67|ORN_PSEAB Oligoribonuclease OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=orn PE=3 SV=1 8 181 5.0E-38
sp|Q5Z0A9|ORN_NOCFA Oligoribonuclease OS=Nocardia farcinica (strain IFM 10152) GN=orn PE=3 SV=1 5 184 5.0E-38
sp|Q8EJ78|ORN_SHEON Oligoribonuclease OS=Shewanella oneidensis (strain MR-1) GN=orn PE=3 SV=1 1 184 7.0E-38
sp|A0QDA8|ORN_MYCA1 Oligoribonuclease OS=Mycobacterium avium (strain 104) GN=orn PE=3 SV=1 8 184 8.0E-38
sp|Q83C93|ORN_COXBU Oligoribonuclease OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=orn PE=1 SV=1 1 180 8.0E-38
sp|P61651|ORN_MYCPA Oligoribonuclease OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=orn PE=3 SV=1 8 184 8.0E-38
sp|Q0HR35|ORN_SHESR Oligoribonuclease OS=Shewanella sp. (strain MR-7) GN=orn PE=3 SV=1 1 184 9.0E-38
sp|Q0HMP6|ORN_SHESM Oligoribonuclease OS=Shewanella sp. (strain MR-4) GN=orn PE=3 SV=1 1 184 9.0E-38
sp|Q7VNN8|ORN_HAEDU Oligoribonuclease OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=orn PE=3 SV=1 8 181 1.0E-37
sp|A6VN13|ORN_ACTSZ Oligoribonuclease OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=orn PE=3 SV=1 1 181 2.0E-37
sp|Q1LSQ0|ORN_BAUCH Oligoribonuclease OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=orn PE=3 SV=1 8 180 2.0E-37
sp|Q39IC7|ORN_BURL3 Oligoribonuclease OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=orn PE=3 SV=1 8 181 2.0E-37
sp|Q3SHU1|ORN_THIDA Oligoribonuclease OS=Thiobacillus denitrificans (strain ATCC 25259) GN=orn PE=3 SV=1 1 181 3.0E-37
sp|Q556Y2|ORN_DICDI Probable oligoribonuclease OS=Dictyostelium discoideum GN=rexo2-1 PE=3 SV=1 8 184 6.0E-37
sp|O07708|ORN_MYCLE Oligoribonuclease OS=Mycobacterium leprae (strain TN) GN=orn PE=3 SV=1 8 184 9.0E-37
sp|A1SA28|ORN_SHEAM Oligoribonuclease OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=orn PE=3 SV=1 1 184 9.0E-37
sp|Q0VME0|ORN_ALCBS Oligoribonuclease OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=orn PE=3 SV=1 1 181 9.0E-37
sp|A0PU74|ORN_MYCUA Oligoribonuclease OS=Mycobacterium ulcerans (strain Agy99) GN=orn PE=3 SV=1 8 184 1.0E-36
sp|Q88DC5|ORN_PSEPK Oligoribonuclease OS=Pseudomonas putida (strain KT2440) GN=orn PE=3 SV=1 8 181 1.0E-36
sp|A5W9T8|ORN_PSEP1 Oligoribonuclease OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=orn PE=3 SV=1 8 181 1.0E-36
sp|Q8XDP0|ORN_ECO57 Oligoribonuclease OS=Escherichia coli O157:H7 GN=orn PE=3 SV=2 1 181 1.0E-36
sp|Q17819|ORN_CAEEL Probable oligoribonuclease OS=Caenorhabditis elegans GN=C08B6.8 PE=3 SV=1 8 186 2.0E-36
sp|P57885|ORN_PASMU Oligoribonuclease OS=Pasteurella multocida (strain Pm70) GN=orn PE=3 SV=1 1 181 2.0E-36
sp|A6WSV9|ORN_SHEB8 Oligoribonuclease OS=Shewanella baltica (strain OS185) GN=orn PE=3 SV=1 1 184 2.0E-36
sp|A3D017|ORN_SHEB5 Oligoribonuclease OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=orn PE=3 SV=1 1 184 2.0E-36
sp|Q12J88|ORN_SHEDO Oligoribonuclease OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=orn PE=3 SV=1 1 184 2.0E-36
sp|Q6AEG5|ORN_LEIXX Oligoribonuclease OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=orn PE=3 SV=1 1 184 2.0E-36
sp|A3N1D8|ORN_ACTP2 Oligoribonuclease OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=orn PE=3 SV=1 4 180 2.0E-36
sp|A4VR15|ORN_PSEU5 Oligoribonuclease OS=Pseudomonas stutzeri (strain A1501) GN=orn PE=3 SV=1 8 181 3.0E-36
sp|Q1I440|ORN_PSEE4 Oligoribonuclease OS=Pseudomonas entomophila (strain L48) GN=orn PE=3 SV=1 8 181 3.0E-36
sp|A1RFR0|ORN_SHESW Oligoribonuclease OS=Shewanella sp. (strain W3-18-1) GN=orn PE=3 SV=1 1 184 5.0E-36
sp|A4YAL6|ORN_SHEPC Oligoribonuclease OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=orn PE=3 SV=1 1 184 5.0E-36
sp|Q83GA7|ORN_TROWT Oligoribonuclease OS=Tropheryma whipplei (strain Twist) GN=orn PE=3 SV=1 8 181 6.0E-36
sp|Q83HW9|ORN_TROW8 Oligoribonuclease OS=Tropheryma whipplei (strain TW08/27) GN=orn PE=3 SV=1 8 181 6.0E-36
sp|Q8FMX9|ORN_COREF Oligoribonuclease OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=orn PE=3 SV=1 1 184 7.0E-36
sp|A4SJD0|ORN_AERS4 Oligoribonuclease OS=Aeromonas salmonicida (strain A449) GN=orn PE=3 SV=1 1 184 8.0E-36
sp|A0KNT4|ORN_AERHH Oligoribonuclease OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=orn PE=3 SV=1 1 184 1.0E-35
sp|A5UFF2|ORN_HAEIG Oligoribonuclease OS=Haemophilus influenzae (strain PittGG) GN=orn PE=3 SV=1 1 181 1.0E-35
sp|Q8NMU1|ORN_CORGL Oligoribonuclease OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=orn PE=3 SV=1 1 184 2.0E-35
sp|Q13VF8|ORN_BURXL Oligoribonuclease OS=Burkholderia xenovorans (strain LB400) GN=orn PE=3 SV=1 5 181 2.0E-35
sp|P45340|ORN_HAEIN Oligoribonuclease OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=orn PE=1 SV=1 1 181 2.0E-35
sp|P65599|ORN_SALTY Oligoribonuclease OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=orn PE=3 SV=2 1 181 2.0E-35
sp|P65600|ORN_SALTI Oligoribonuclease OS=Salmonella typhi GN=orn PE=3 SV=2 1 181 2.0E-35
sp|Q5PLG7|ORN_SALPA Oligoribonuclease OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=orn PE=3 SV=3 1 181 2.0E-35
sp|Q57GM7|ORN_SALCH Oligoribonuclease OS=Salmonella choleraesuis (strain SC-B67) GN=orn PE=3 SV=3 1 181 2.0E-35
sp|P0A784|ORN_ECOLI Oligoribonuclease OS=Escherichia coli (strain K12) GN=orn PE=1 SV=2 1 181 2.0E-35
sp|P0A785|ORN_ECOL6 Oligoribonuclease OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=orn PE=3 SV=2 1 181 2.0E-35
sp|A8A7Q9|ORN_ECOHS Oligoribonuclease OS=Escherichia coli O9:H4 (strain HS) GN=orn PE=3 SV=1 1 181 2.0E-35
sp|A7ZV33|ORN_ECO24 Oligoribonuclease OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=orn PE=3 SV=1 1 181 2.0E-35
sp|Q83IJ9|ORN_SHIFL Oligoribonuclease OS=Shigella flexneri GN=orn PE=3 SV=3 1 181 2.0E-35
sp|A5UBG1|ORN_HAEIE Oligoribonuclease OS=Haemophilus influenzae (strain PittEE) GN=orn PE=3 SV=1 1 181 3.0E-35
sp|Q4QJM8|ORN_HAEI8 Oligoribonuclease OS=Haemophilus influenzae (strain 86-028NP) GN=orn PE=3 SV=1 1 181 3.0E-35
sp|A4QGM5|ORN_CORGB Oligoribonuclease OS=Corynebacterium glutamicum (strain R) GN=orn PE=3 SV=1 1 184 3.0E-35
sp|Q2NW86|ORN_SODGM Oligoribonuclease OS=Sodalis glossinidius (strain morsitans) GN=orn PE=3 SV=1 1 181 3.0E-35
sp|Q6A786|ORN_PROAC Oligoribonuclease OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=orn PE=3 SV=1 8 184 4.0E-35
sp|Q7MYS8|ORN_PHOLL Oligoribonuclease OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=orn PE=3 SV=1 1 181 7.0E-35
sp|A4W5Q6|ORN_ENT38 Oligoribonuclease OS=Enterobacter sp. (strain 638) GN=orn PE=3 SV=1 1 181 8.0E-35
sp|A1JIQ8|ORN_YERE8 Oligoribonuclease OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=orn PE=3 SV=1 1 181 9.0E-35
sp|Q8K909|ORN_BUCAP Oligoribonuclease OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=orn PE=3 SV=1 1 184 3.0E-34
sp|Q66FC2|ORN_YERPS Oligoribonuclease OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=orn PE=3 SV=1 1 181 3.0E-34
sp|A7FMY7|ORN_YERP3 Oligoribonuclease OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=orn PE=3 SV=1 1 181 3.0E-34
sp|A1WB43|ORN_ACISJ Oligoribonuclease OS=Acidovorax sp. (strain JS42) GN=orn PE=3 SV=1 1 180 5.0E-34
sp|A6TH79|ORN_KLEP7 Oligoribonuclease OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=orn PE=3 SV=1 1 181 6.0E-34
sp|Q8ZIW9|ORN_YERPE Oligoribonuclease OS=Yersinia pestis GN=orn PE=3 SV=1 1 181 6.0E-34
sp|Q5WT59|ORN_LEGPL Oligoribonuclease OS=Legionella pneumophila (strain Lens) GN=orn PE=3 SV=1 4 180 6.0E-34
sp|Q5ZRY0|ORN_LEGPH Oligoribonuclease OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=orn PE=3 SV=1 4 180 6.0E-34
sp|A5IAI0|ORN_LEGPC Oligoribonuclease OS=Legionella pneumophila (strain Corby) GN=orn PE=3 SV=1 4 180 6.0E-34
sp|Q5X1E6|ORN_LEGPA Oligoribonuclease OS=Legionella pneumophila (strain Paris) GN=orn PE=3 SV=1 4 180 6.0E-34
sp|A8AMN6|ORN_CITK8 Oligoribonuclease OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=orn PE=3 SV=1 1 181 8.0E-34
sp|A5EY84|ORN_DICNV Oligoribonuclease OS=Dichelobacter nodosus (strain VCS1703A) GN=orn PE=3 SV=1 8 184 8.0E-34
sp|A8G8U2|ORN_SERP5 Oligoribonuclease OS=Serratia proteamaculans (strain 568) GN=orn PE=3 SV=1 1 181 9.0E-34
sp|Q07XW1|ORN_SHEFN Oligoribonuclease OS=Shewanella frigidimarina (strain NCIMB 400) GN=orn PE=3 SV=1 1 184 1.0E-33
sp|A1TND9|ORN_ACIAC Oligoribonuclease OS=Acidovorax citrulli (strain AAC00-1) GN=orn PE=3 SV=1 1 180 1.0E-33
sp|Q5QVW2|ORN_IDILO Oligoribonuclease OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=orn PE=3 SV=1 8 186 1.0E-33
sp|Q4KJ81|ORN_PSEF5 Oligoribonuclease OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=orn PE=3 SV=1 8 180 2.0E-33
sp|Q0A8I6|ORN_ALKEH Oligoribonuclease OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=orn PE=3 SV=1 1 180 2.0E-33
sp|Q63S41|ORN_BURPS Oligoribonuclease OS=Burkholderia pseudomallei (strain K96243) GN=orn PE=3 SV=1 8 181 4.0E-33
sp|A3NXT2|ORN_BURP0 Oligoribonuclease OS=Burkholderia pseudomallei (strain 1106a) GN=orn PE=3 SV=1 8 181 4.0E-33
sp|A3NBZ6|ORN_BURP6 Oligoribonuclease OS=Burkholderia pseudomallei (strain 668) GN=orn PE=3 SV=1 8 181 5.0E-33
sp|A1V6I4|ORN_BURMS Oligoribonuclease OS=Burkholderia mallei (strain SAVP1) GN=orn PE=3 SV=1 8 181 5.0E-33
sp|Q62M61|ORN_BURMA Oligoribonuclease OS=Burkholderia mallei (strain ATCC 23344) GN=orn PE=3 SV=1 8 181 5.0E-33
sp|A2S4M9|ORN_BURM9 Oligoribonuclease OS=Burkholderia mallei (strain NCTC 10229) GN=orn PE=3 SV=1 8 181 5.0E-33
sp|A3MHS8|ORN_BURM7 Oligoribonuclease OS=Burkholderia mallei (strain NCTC 10247) GN=orn PE=3 SV=1 8 181 5.0E-33
sp|Q0BNX6|ORN_FRATO Oligoribonuclease OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=orn PE=3 SV=1 8 185 6.0E-33
sp|A4J020|ORN_FRATW Oligoribonuclease OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=orn PE=3 SV=1 8 185 6.0E-33
sp|Q2A5M3|ORN_FRATH Oligoribonuclease OS=Francisella tularensis subsp. holarctica (strain LVS) GN=orn PE=3 SV=1 8 185 6.0E-33
sp|A7N9M1|ORN_FRATF Oligoribonuclease OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=orn PE=3 SV=1 8 185 6.0E-33
sp|P61650|ORN_CORDI Oligoribonuclease OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=orn PE=3 SV=1 8 182 7.0E-33
sp|A4XPY0|ORN_PSEMY Oligoribonuclease OS=Pseudomonas mendocina (strain ymp) GN=orn PE=3 SV=1 8 180 9.0E-33
sp|Q3KIZ7|ORN_PSEPF Oligoribonuclease OS=Pseudomonas fluorescens (strain Pf0-1) GN=orn PE=3 SV=1 8 180 2.0E-32
sp|Q5NI61|ORN_FRATT Oligoribonuclease OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=orn PE=3 SV=1 8 185 2.0E-32
sp|Q14JL3|ORN_FRAT1 Oligoribonuclease OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=orn PE=3 SV=1 8 185 2.0E-32
sp|Q8G3N5|ORN_BIFLO Oligoribonuclease OS=Bifidobacterium longum (strain NCC 2705) GN=orn PE=3 SV=1 5 196 6.0E-32
sp|A0Q414|ORN_FRATN Oligoribonuclease OS=Francisella tularensis subsp. novicida (strain U112) GN=orn PE=3 SV=1 8 185 6.0E-32
sp|Q0BH60|ORN_BURCM Oligoribonuclease OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=orn PE=3 SV=1 8 180 1.0E-31
sp|A0K5Q4|ORN_BURCH Oligoribonuclease OS=Burkholderia cenocepacia (strain HI2424) GN=orn PE=3 SV=1 8 195 2.0E-31
sp|Q1BXZ5|ORN_BURCA Oligoribonuclease OS=Burkholderia cenocepacia (strain AU 1054) GN=orn PE=3 SV=1 8 195 2.0E-31
sp|Q8PKW8|ORN_XANAC Oligoribonuclease OS=Xanthomonas axonopodis pv. citri (strain 306) GN=orn PE=3 SV=1 8 180 2.0E-31
sp|Q8P8S1|ORN_XANCP Oligoribonuclease OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=orn PE=1 SV=1 8 180 3.0E-31
sp|Q4UVB0|ORN_XANC8 Oligoribonuclease OS=Xanthomonas campestris pv. campestris (strain 8004) GN=orn PE=3 SV=1 8 180 3.0E-31
sp|A4JCK6|ORN_BURVG Oligoribonuclease OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=orn PE=3 SV=1 8 181 3.0E-31
sp|Q3BTI2|ORN_XANC5 Oligoribonuclease OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=orn PE=3 SV=1 8 180 4.0E-31
sp|Q8D2C5|ORN_WIGBR Oligoribonuclease OS=Wigglesworthia glossinidia brevipalpis GN=orn PE=3 SV=1 8 182 4.0E-31
sp|Q5H0Q8|ORN_XANOR Oligoribonuclease OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=orn PE=3 SV=1 8 180 9.0E-31
sp|Q2P3P5|ORN_XANOM Oligoribonuclease OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=orn PE=3 SV=1 8 180 9.0E-31
sp|A1AVF0|ORN_RUTMC Oligoribonuclease OS=Ruthia magnifica subsp. Calyptogena magnifica GN=orn PE=3 SV=1 8 185 7.0E-30
sp|Q7VQP7|ORN_BLOFL Oligoribonuclease OS=Blochmannia floridanus GN=orn PE=3 SV=1 4 187 1.0E-29
sp|Q9PDX2|ORN_XYLFA Oligoribonuclease OS=Xylella fastidiosa (strain 9a5c) GN=orn PE=3 SV=1 5 183 4.0E-27
sp|Q87E07|ORN_XYLFT Oligoribonuclease OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=orn PE=3 SV=1 5 183 8.0E-27
sp|Q89A34|ORN_BUCBP Oligoribonuclease OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=orn PE=3 SV=1 1 150 4.0E-26
sp|P57637|ORN_BUCAI Oligoribonuclease OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=orn PE=3 SV=1 1 175 2.0E-24
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.641 0.5642 0.0617 0.0398 0.2612 0.1135 0.0534 0.1392 0.0281 0.1405

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3796
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3056
Ophiocordyceps australis map64 (Brazil) OphauB2|2957
Ophiocordyceps camponoti-floridani Ophcf2|00204
Ophiocordyceps camponoti-rufipedis Ophun1|6253
Ophiocordyceps kimflemingae Ophio5|6557 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7407

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6557
MATDDGPLVWIDCEMTGLDPDSDEILEIYCLVTNGQLEAVDERGFHAVIHQPQSRLDRMDGWCTTTHGASGLSAA
VVSSTMTAASAADQLLAYITKHVPEPRRALLAGNSVHVDRAFLRRPPYAPVVDHLHYRLLDVSAIKEAARRWCPA
ELLAAAPPKKARHLARDDVLDSIAEARFYRDAVFGRCCGEGGGRSRRRLSFA
Coding >Ophio5|6557
ATGGCCACCGACGACGGACCTCTGGTGTGGATCGACTGCGAGATGACGGGCCTCGACCCGGACAGCGACGAGATC
CTCGAAATCTACTGCCTCGTTACCAACGGCCAGCTCGAAGCGGTCGACGAGCGAGGCTTCCACGCCGTCATCCAT
CAGCCGCAATCACGTCTCGACCGGATGGACGGATGGTGCACGACGACGCACGGCGCATCCGGTCTATCGGCCGCC
GTCGTGTCGTCGACCATGACGGCAGCCTCGGCAGCAGATCAACTGCTGGCCTACATCACCAAGCATGTACCCGAG
CCGCGCAGGGCGCTCTTGGCCGGCAATAGCGTGCACGTCGACCGCGCCTTTCTCCGACGCCCGCCCTACGCGCCC
GTCGTGGACCATTTGCATTATCGTCTACTCGACGTCAGTGCCATCAAGGAGGCTGCTCGTCGCTGGTGTCCTGCC
GAGCTTTTGGCCGCTGCGCCGCCCAAGAAGGCCCGTCATCTGGCCAGGGATGATGTCCTGGACAGTATCGCCGAG
GCCCGCTTCTACCGGGACGCTGTCTTTGGCCGCTGCTGTGGGGAGGGGGGGGGGAGGAGCCGGCGGCGCTTGAGT
TTTGCC
Transcript >Ophio5|6557
ATGGCCACCGACGACGGACCTCTGGTGTGGATCGACTGCGAGATGACGGGCCTCGACCCGGACAGCGACGAGATC
CTCGAAATCTACTGCCTCGTTACCAACGGCCAGCTCGAAGCGGTCGACGAGCGAGGCTTCCACGCCGTCATCCAT
CAGCCGCAATCACGTCTCGACCGGATGGACGGATGGTGCACGACGACGCACGGCGCATCCGGTCTATCGGCCGCC
GTCGTGTCGTCGACCATGACGGCAGCCTCGGCAGCAGATCAACTGCTGGCCTACATCACCAAGCATGTACCCGAG
CCGCGCAGGGCGCTCTTGGCCGGCAATAGCGTGCACGTCGACCGCGCCTTTCTCCGACGCCCGCCCTACGCGCCC
GTCGTGGACCATTTGCATTATCGTCTACTCGACGTCAGTGCCATCAAGGAGGCTGCTCGTCGCTGGTGTCCTGCC
GAGCTTTTGGCCGCTGCGCCGCCCAAGAAGGCCCGTCATCTGGCCAGGGATGATGTCCTGGACAGTATCGCCGAG
GCCCGCTTCTACCGGGACGCTGTCTTTGGCCGCTGCTGTGGGGAGGGGGGGGGGAGGAGCCGGCGGCGCTTGAGT
TTTGCCTGA
Gene >Ophio5|6557
ATGGCCACCGACGACGGACCTCTGGTGTGGATCGACTGCGAGGTTGGACAAGGCCGCATTTGCCCCGAGTCTCCC
CCGACGCTGAAGCGCGGCAGCTAAAAAAGGGTTGGGCATGGCAGATGACGGGCCTCGACCCGGACAGCGACGAGA
TCCTCGAAATCTACTGCCTCGTTACCAACGGCCAGCTCGAAGCGGTCGACGAGCGAGGCTTCCACGCCGTCATCC
ATCAGCCGCAATCACGTCTCGACCGGATGGACGGATGGTGCACGACGACGCACGGCGCATCCGGTCTATCGGCCG
CCGTCGTGTCGTCGACCATGACGGCAGCCTCGGCAGCAGATCAACTGCTGGCCTACATCACCAAGCATGTACCCG
AGCCGCGCAGGGCGCTCTTGGCCGGCAATAGCGTGCACGTCGACCGCGCCTTTCTCCGACGCCCGCCCTACGCGC
CCGTCGTGGACCATTTGCATTATCGTCTACTCGACGTCAGTGCCATCAAGGAGGCTGCTCGTCGCTGGTGTCCTG
CCGAGCTTTTGGCCGCTGCGCCGCCCAAGAAGGCCCGTCATCTGGCCAGGGATGATGTCCTGGACAGTATCGCCG
AGGCCCGCTTCTACCGGGACGCTGTCTTTGGCCGCTGCTGTGGGGAGGGGGGGGGGAGGAGCCGGCGGCGCTTGA
GTTTTGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail