Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6554
Gene name
Locationscaffold_58:43055..44523
Strand+
Gene length (bp)1468
Transcript length (bp)687
Coding sequence length (bp)684
Protein length (aa) 228

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00505 HMG_box HMG (high mobility group) box 2.1E-09 177 213

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S045|NHP6_NEUCR Non-histone chromosomal protein 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nhp-1 PE=3 SV=1 153 212 4.0E-27
sp|Q4IQX3|NHP6_GIBZE Non-histone chromosomal protein 6 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NHP6 PE=3 SV=1 168 212 1.0E-23
sp|Q4WY33|NHP6_ASPFU Non-histone chromosomal protein 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nhp6 PE=3 SV=1 153 212 9.0E-22
sp|Q5B995|NHP6_EMENI Non-histone chromosomal protein 6 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nhp6 PE=3 SV=1 153 212 1.0E-20
sp|Q6CVH3|NHP6_KLULA Non-histone chromosomal protein 6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NHP6 PE=3 SV=1 168 212 2.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S045|NHP6_NEUCR Non-histone chromosomal protein 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nhp-1 PE=3 SV=1 153 212 4.0E-27
sp|Q4IQX3|NHP6_GIBZE Non-histone chromosomal protein 6 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NHP6 PE=3 SV=1 168 212 1.0E-23
sp|Q4WY33|NHP6_ASPFU Non-histone chromosomal protein 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nhp6 PE=3 SV=1 153 212 9.0E-22
sp|Q5B995|NHP6_EMENI Non-histone chromosomal protein 6 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nhp6 PE=3 SV=1 153 212 1.0E-20
sp|Q6CVH3|NHP6_KLULA Non-histone chromosomal protein 6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NHP6 PE=3 SV=1 168 212 2.0E-18
sp|P11633|NHP6B_YEAST Non-histone chromosomal protein 6B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHP6B PE=1 SV=3 169 212 5.0E-18
sp|Q75B82|NHP6_ASHGO Non-histone chromosomal protein 6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NHP6 PE=3 SV=1 173 212 1.0E-16
sp|Q6BRB4|NHP6_DEBHA Non-histone chromosomal protein 6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NHP6 PE=3 SV=1 173 213 3.0E-16
sp|Q9UVL1|NHP6_CANAL Non-histone chromosomal protein 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NHP6 PE=3 SV=1 173 213 4.0E-16
sp|Q6CC79|NHP6_YARLI Non-histone chromosomal protein 6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NHP6 PE=3 SV=1 153 213 1.0E-15
sp|P11632|NHP6A_YEAST Non-histone chromosomal protein 6A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHP6A PE=1 SV=1 173 212 5.0E-15
sp|P0CO24|NHP6_CRYNJ Non-histone chromosomal protein 6 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NHP6 PE=3 SV=1 153 212 2.0E-14
sp|P0CO25|NHP6_CRYNB Non-histone chromosomal protein 6 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NHP6 PE=3 SV=1 153 212 2.0E-14
sp|Q4PBZ9|NHP6_USTMA Non-histone chromosomal protein 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NHP6 PE=3 SV=2 169 212 2.0E-12
sp|P87057|NHP6_SCHPO Non-histone chromosomal protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nhp6 PE=3 SV=1 153 213 2.0E-11
sp|Q39601|SSRP1_CATRO FACT complex subunit SSRP1 OS=Catharanthus roseus GN=SSRP1 PE=2 SV=1 173 228 2.0E-10
sp|O04235|SSRP1_VICFA FACT complex subunit SSRP1 OS=Vicia faba GN=SSRP1 PE=2 SV=1 173 213 4.0E-10
sp|P40632|NHP1_BABBO High mobility group protein homolog NHP1 OS=Babesia bovis PE=1 SV=1 168 212 1.0E-09
sp|Q24537|HMG2_DROME High mobility group protein DSP1 OS=Drosophila melanogaster GN=Dsp1 PE=2 SV=1 154 213 2.0E-08
sp|Q9W602|SSRP1_XENLA FACT complex subunit SSRP1 OS=Xenopus laevis GN=ssrp1 PE=1 SV=1 160 228 1.0E-07
sp|Q08943|SSRP1_MOUSE FACT complex subunit SSRP1 OS=Mus musculus GN=Ssrp1 PE=1 SV=2 152 218 1.0E-07
sp|Q04678|SSRP1_CHICK FACT complex subunit SSRP1 OS=Gallus gallus GN=SSRP1 PE=2 SV=2 164 228 3.0E-07
sp|Q08945|SSRP1_HUMAN FACT complex subunit SSRP1 OS=Homo sapiens GN=SSRP1 PE=1 SV=1 153 218 1.0E-06
sp|Q05153|SSRP1_ARATH FACT complex subunit SSRP1 OS=Arabidopsis thaliana GN=SSRP1 PE=1 SV=2 179 223 1.0E-06
sp|Q09390|HMG12_CAEEL High mobility group protein 1.2 OS=Caenorhabditis elegans GN=hmg-1.2 PE=1 SV=2 156 213 1.0E-06
sp|Q4H2R2|SSRP1_CIOIN FACT complex subunit SSRP1 OS=Ciona intestinalis GN=SSRP1 PE=2 SV=1 168 213 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
HMG

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6554
MYWTTRRPCLGTSWLCPLMAFLHPHTTAAHTHTHTSALSGHSYAPAPALRPQSLAHSKKAAWPSPHTCAPLLSLL
PYKNRPPNFSLPRRVHFATLHARSLKSYHRLYPVVVEKLLLRDAKKTLHTSSAHHRPHTFTDFSASQPTRSFSHA
TKMPKAAAGKRGAKEVKRRGKKDPNAPKRGLSAYMFFANEQRENVREENPGISFGQVGKILGRCRQEEIRGREAS
VQR
Coding >Ophio5|6554
ATGTACTGGACCACTCGTCGGCCGTGCCTCGGTACCTCGTGGCTTTGCCCATTGATGGCGTTCCTCCACCCACAC
ACCACAGCAGCACACACACACACACACACAAGCGCACTGTCAGGTCACTCCTACGCACCCGCACCCGCTTTGCGC
CCGCAATCACTCGCCCATAGTAAAAAGGCTGCTTGGCCCTCCCCCCATACTTGCGCTCCCCTCCTCTCTCTTCTC
CCATACAAAAATCGCCCGCCAAATTTCTCCCTACCCCGACGAGTCCACTTCGCGACGCTTCACGCCCGTTCTTTG
AAGTCGTATCATCGTCTTTATCCTGTCGTCGTAGAAAAGCTGCTCTTGAGAGACGCGAAAAAAACGCTTCACACA
AGCAGCGCACATCACCGCCCTCACACTTTTACCGATTTCTCTGCCTCTCAACCCACACGCTCCTTCTCCCACGCG
ACCAAAATGCCGAAAGCAGCCGCCGGGAAGCGTGGTGCAAAGGAGGTAAAGAGGCGTGGCAAGAAAGATCCCAAT
GCCCCCAAGCGCGGTCTCTCAGCCTACATGTTTTTCGCGAATGAGCAGCGTGAGAACGTGCGCGAAGAGAATCCC
GGCATTTCGTTTGGCCAAGTTGGCAAGATCCTGGGCCGCTGCCGACAAGAAGAGATACGAGGACGAGAAGCAAGC
GTACAACGC
Transcript >Ophio5|6554
ATGTACTGGACCACTCGTCGGCCGTGCCTCGGTACCTCGTGGCTTTGCCCATTGATGGCGTTCCTCCACCCACAC
ACCACAGCAGCACACACACACACACACACAAGCGCACTGTCAGGTCACTCCTACGCACCCGCACCCGCTTTGCGC
CCGCAATCACTCGCCCATAGTAAAAAGGCTGCTTGGCCCTCCCCCCATACTTGCGCTCCCCTCCTCTCTCTTCTC
CCATACAAAAATCGCCCGCCAAATTTCTCCCTACCCCGACGAGTCCACTTCGCGACGCTTCACGCCCGTTCTTTG
AAGTCGTATCATCGTCTTTATCCTGTCGTCGTAGAAAAGCTGCTCTTGAGAGACGCGAAAAAAACGCTTCACACA
AGCAGCGCACATCACCGCCCTCACACTTTTACCGATTTCTCTGCCTCTCAACCCACACGCTCCTTCTCCCACGCG
ACCAAAATGCCGAAAGCAGCCGCCGGGAAGCGTGGTGCAAAGGAGGTAAAGAGGCGTGGCAAGAAAGATCCCAAT
GCCCCCAAGCGCGGTCTCTCAGCCTACATGTTTTTCGCGAATGAGCAGCGTGAGAACGTGCGCGAAGAGAATCCC
GGCATTTCGTTTGGCCAAGTTGGCAAGATCCTGGGCCGCTGCCGACAAGAAGAGATACGAGGACGAGAAGCAAGC
GTACAACGCTGA
Gene >Ophio5|6554
ATGTACTGGACCACTCGTCGGCCGTGCCTCGGTACCTCGTGGCTTTGCCCATTGATGGCGTTCCTCCACCCACAC
ACCACAGCAGCACACACACACACACACACAAGCGCACTGTCAGGTCACTCCTACGCACCCGCACCCGCTTTGCGC
CCGCAATCACTCGCCCATAGTAAAAAGGCTGCTTGGCCCTCCCCCCATACTTGCGCTCCCCTCCTCTCTCTTCTC
CCATACAAAAATCGCCCGCCAAATTTCTCCCTACCCCGACGAGTCCACTTCGCGACGCTTCACGCCCGTTCTTTG
GTGAGTACTTTATTTTGCACCTTGTTGATTGCCAATCCCAAGTATCTCCTTCAATTTGCCCGACGCCGTTGCGCA
CCGAGCCGCCACGCCTGGTGTTTCCCCCCCCCCCCCCCTTTGCTGCAGTTTTCATTTTTAATTTTCATCGGCGTC
GCCCCTCCTCTTTTCTGACCCATCCCCTTTTCCCTCTTCGTCGACCATCCCCTTGGTCCCTCTTCGCCTCGCGCG
GTGCATCTTGAAAATGTTTTTGTGGTTTTCTTCGCGCGCATCGTCGTTTTCGGCCCGCAACGTTCGCCACGTGCT
AACCTTGCCGTTGCAGAAGTCGTATCATCGTCTTTATCCTGTCGTCGTAGAAAAGCTGCTCTTGAGAGACGCGAA
AAAAACGGTACGTGAGCCGCATCTCTCGCCCTCTGTTTTTGCCTCCGCCACGCATTCGTTGCCCCGATGCCTCCT
TTTCCTTTGCACCTGTCCACACTACACACTCTACCCCCTTCTCTGCCCGTGCCACTCAAAACACGCCACCCCTTC
GCCCAGCTGTTACGCGTCTTTGCCTTGACCCTTGACCAAACTATCACCACCACCAACACCAATCAAATCCCTTGC
ACTGTTCTGTCGCCATACCCTTTACGTTACCTTTTTAATCCACACCCTTCGCGCGTTCTTGCAGCTTCTAACGCT
CGCACCGACAGCTTCACACAAGCAGCGCACATCACCGCCCTCACACTTTTACCGATTTCTCTGCCTCTCAACCCA
CACGCTCCTTCTCCCACGCGACCAAAATGCCGAAAGCAGCCGCCGGGAAGCGTGGTGCAAAGGAGGTAAAGAGGC
GTGGCAAGAAAGGTCAGTCGGCATTCCTGCGTGCCCATGGCCTTCAGAATGCTGACGACTGGCAGATCCCAATGC
CCCCAAGCGCGGTCTCTCAGCCTACATGTTTTTCGCGAATGAGCAGCGTGAGAACGTGCGCGAAGAGAATCCCGG
CATTTCGTTTGGCCAAGTTGGCAAGATCCTGGGTGAGCGATGGAAGGCACTCAACGACAAGCAGCGCGCGCCTTA
CGAGGCCAAGGCCGCTGCCGACAAGAAGAGATACGAGGACGAGAAGCAAGCGTACAACGTATGGAGAACCAAACT
GCCTATGACGCGCAAGGGCTTACTGACGCGCTTCGCAGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail