Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|655
Gene name
Locationscaffold_1178:289..2192
Strand+
Gene length (bp)1903
Transcript length (bp)1629
Coding sequence length (bp)1626
Protein length (aa) 542

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 5.1E-76 56 508
PF07690 MFS_1 Major Facilitator Superfamily 9.3E-25 60 447

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 54 508 6.0E-52
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 48 511 2.0E-47
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 48 511 2.0E-47
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 54 506 3.0E-47
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 57 506 7.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 54 508 6.0E-52
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 48 511 2.0E-47
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 48 511 2.0E-47
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 54 506 3.0E-47
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 57 506 7.0E-47
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 50 526 1.0E-46
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 58 506 1.0E-46
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 58 531 3.0E-46
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 58 531 3.0E-46
sp|Q6AWX0|XYLL2_ARATH D-xylose-proton symporter-like 2 OS=Arabidopsis thaliana GN=At5g17010 PE=1 SV=1 57 507 1.0E-44
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 53 506 6.0E-44
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 57 519 1.0E-43
sp|Q8L6Z8|XYLL1_ARATH D-xylose-proton symporter-like 1 OS=Arabidopsis thaliana GN=At3g03090 PE=2 SV=1 57 507 2.0E-43
sp|Q0WWW9|XYLL3_ARATH D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana GN=At5g59250 PE=2 SV=2 47 507 5.0E-43
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 58 506 5.0E-43
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 4 509 2.0E-42
sp|Q10286|ITR1_SCHPO Myo-inositol transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr1 PE=3 SV=1 50 533 2.0E-42
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 32 527 9.0E-41
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 58 509 2.0E-40
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 58 522 6.0E-40
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 50 511 8.0E-40
sp|Q94AZ2|STP13_ARATH Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2 69 505 1.0E-39
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 35 407 3.0E-39
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 57 509 7.0E-39
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 31 508 9.0E-39
sp|Q9FMX3|STP11_ARATH Sugar transport protein 11 OS=Arabidopsis thaliana GN=STP11 PE=1 SV=1 50 508 3.0E-38
sp|O04249|STP7_ARATH Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1 94 511 2.0E-37
sp|Q9SBA7|STP8_ARATH Sugar transport protein 8 OS=Arabidopsis thaliana GN=STP8 PE=2 SV=2 50 506 3.0E-37
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 49 510 8.0E-37
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 50 394 8.0E-37
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 58 513 1.0E-36
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 58 513 1.0E-36
sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 43 528 2.0E-36
sp|Q9LNV3|STP2_ARATH Sugar transport protein 2 OS=Arabidopsis thaliana GN=STP2 PE=1 SV=3 52 505 3.0E-36
sp|Q39228|STP4_ARATH Sugar transport protein 4 OS=Arabidopsis thaliana GN=STP4 PE=1 SV=1 91 508 3.0E-36
sp|Q9LT15|STP10_ARATH Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1 58 511 5.0E-36
sp|Q9SFG0|STP6_ARATH Sugar transport protein 6 OS=Arabidopsis thaliana GN=STP6 PE=1 SV=1 50 512 6.0E-36
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 43 395 1.0E-35
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 57 511 2.0E-35
sp|Q10710|STA_RICCO Sugar carrier protein A OS=Ricinus communis GN=STA PE=2 SV=1 86 520 2.0E-35
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 50 394 3.0E-35
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 66 506 7.0E-35
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 53 506 8.0E-35
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 58 390 2.0E-34
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 50 394 2.0E-34
sp|P15686|HUP1_PARKE H(+)/hexose cotransporter 1 OS=Parachlorella kessleri GN=HUP1 PE=2 SV=2 53 511 4.0E-34
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 58 511 1.0E-33
sp|P23586|STP1_ARATH Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2 58 508 1.0E-33
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 27 510 2.0E-33
sp|Q0WQ63|ERDL8_ARATH Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana GN=At3g05150 PE=2 SV=1 81 509 2.0E-33
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 45 506 3.0E-33
sp|P49374|HGT1_KLULA High-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HGT1 PE=3 SV=1 38 506 2.0E-31
sp|Q39525|HUP3_PARKE H(+)/hexose cotransporter 3 OS=Parachlorella kessleri GN=HUP3 PE=2 SV=1 151 511 5.0E-31
sp|Q8GW61|STP14_ARATH Sugar transport protein 14 OS=Arabidopsis thaliana GN=STP14 PE=2 SV=2 115 505 6.0E-31
sp|O65413|STP12_ARATH Sugar transport protein 12 OS=Arabidopsis thaliana GN=STP12 PE=2 SV=1 58 508 1.0E-30
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 36 508 2.0E-30
sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT9 PE=1 SV=1 53 508 2.0E-30
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 43 506 1.0E-29
sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 73 510 1.0E-29
sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1 53 508 1.0E-29
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 44 534 2.0E-29
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 58 511 2.0E-29
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 54 515 2.0E-29
sp|P10870|SNF3_YEAST High-affinity glucose transporter SNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF3 PE=1 SV=3 57 506 2.0E-29
sp|P15729|GLCP_SYNY3 Glucose transport protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gtr PE=3 SV=2 49 505 7.0E-29
sp|Q39524|HUP2_PARKE H(+)/hexose cotransporter 2 OS=Parachlorella kessleri GN=HUP2 PE=2 SV=1 31 511 1.0E-28
sp|P0C6A1|GTR7_MOUSE Solute carrier family 2, facilitated glucose transporter member 7 OS=Mus musculus GN=Slc2a7 PE=3 SV=1 91 511 1.0E-28
sp|Q8L7R8|STP3_ARATH Sugar transport protein 3 OS=Arabidopsis thaliana GN=STP3 PE=2 SV=2 106 505 2.0E-28
sp|B4QBN3|TRE12_DROSI Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila simulans GN=Tret1-2 PE=3 SV=1 53 506 5.0E-28
sp|Q8BFW9|GTR12_MOUSE Solute carrier family 2, facilitated glucose transporter member 12 OS=Mus musculus GN=Slc2a12 PE=2 SV=1 26 373 1.0E-27
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 53 506 5.0E-27
sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 53 511 6.0E-27
sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3 53 521 7.0E-27
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 52 506 7.0E-27
sp|B4HNS1|TRE12_DROSE Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila sechellia GN=Tret1-2 PE=3 SV=1 41 506 9.0E-27
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 52 506 9.0E-27
sp|Q32NG5|GTR12_XENLA Solute carrier family 2, facilitated glucose transporter member 12 OS=Xenopus laevis GN=slc2a12 PE=2 SV=1 45 373 1.0E-26
sp|Q4U3U6|QAY_NEUAF Quinate permease OS=Neurospora africana GN=qa-y PE=3 SV=1 56 519 1.0E-26
sp|Q3ECP7|ERDL5_ARATH Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2 79 506 1.0E-26
sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 79 506 2.0E-26
sp|Q8IRI6|GTR1_DROME Glucose transporter type 1 OS=Drosophila melanogaster GN=Glut1 PE=2 SV=4 115 505 5.0E-26
sp|Q8LBI9|EDL16_ARATH Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2 81 513 5.0E-26
sp|Q8TD20|GTR12_HUMAN Solute carrier family 2, facilitated glucose transporter member 12 OS=Homo sapiens GN=SLC2A12 PE=2 SV=1 50 373 6.0E-26
sp|Q94CI7|EDL17_ARATH Sugar transporter ERD6-like 17 OS=Arabidopsis thaliana GN=SFP1 PE=2 SV=2 53 509 6.0E-26
sp|Q6MYX6|QUTD_ASPFU Probable quinate permease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=qutD PE=3 SV=1 43 535 7.0E-26
sp|Q6NWF1|GTR12_DANRE Solute carrier family 2, facilitated glucose transporter member 12 OS=Danio rerio GN=slc2a12 PE=2 SV=2 55 373 7.0E-26
sp|Q9UGQ3|GTR6_HUMAN Solute carrier family 2, facilitated glucose transporter member 6 OS=Homo sapiens GN=SLC2A6 PE=1 SV=2 79 507 8.0E-26
sp|Q9FRL3|ERDL6_ARATH Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana GN=At1g75220 PE=1 SV=1 79 508 8.0E-26
sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT2 PE=1 SV=1 57 511 1.0E-25
sp|Q9BE72|GTR12_MACFA Solute carrier family 2, facilitated glucose transporter member 12 OS=Macaca fascicularis GN=SLC2A12 PE=2 SV=1 50 373 2.0E-25
sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 50 506 3.0E-25
sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 50 506 3.0E-25
sp|Q93Y91|STP5_ARATH Sugar transport protein 5 OS=Arabidopsis thaliana GN=STP5 PE=2 SV=1 105 511 3.0E-25
sp|B4HNS0|TRE11_DROSE Facilitated trehalose transporter Tret1-1 OS=Drosophila sechellia GN=Tret1-1 PE=3 SV=1 91 506 3.0E-25
sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens GN=SLC2A9 PE=1 SV=2 99 511 3.0E-25
sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 PE=1 SV=1 53 508 4.0E-25
sp|P11636|QAY_NEUCR Quinate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-y PE=3 SV=2 56 534 5.0E-25
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 52 506 5.0E-25
sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 66 513 6.0E-25
sp|A6ZT02|HXT4_YEAS7 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain YJM789) GN=HXT4 PE=3 SV=1 53 508 6.0E-25
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 48 508 8.0E-25
sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 13 515 8.0E-25
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 56 518 1.0E-24
sp|C7GWV6|HXT4_YEAS2 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain JAY291) GN=HXT4 PE=3 SV=1 53 508 1.0E-24
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 51 506 1.0E-24
sp|A1D2R3|QUTD_NEOFI Probable quinate permease OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=qutD PE=3 SV=1 43 535 1.0E-24
sp|Q9M0Z9|EDL15_ARATH Sugar transporter ERD6-like 15 OS=Arabidopsis thaliana GN=At4g04760 PE=3 SV=2 81 515 2.0E-24
sp|P43581|HXT10_YEAST Hexose transporter HXT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT10 PE=1 SV=1 53 506 2.0E-24
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 53 506 2.0E-24
sp|A5LGM7|TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki GN=Tret1 PE=1 SV=1 27 506 2.0E-24
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 110 535 2.0E-24
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 55 510 3.0E-24
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 52 506 3.0E-24
sp|P40441|HXT12_YEAST Putative hexose transporter 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT12 PE=5 SV=1 92 508 4.0E-24
sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 50 506 4.0E-24
sp|Q5J316|GTR12_BOVIN Solute carrier family 2, facilitated glucose transporter member 12 OS=Bos taurus GN=SLC2A12 PE=1 SV=1 50 373 4.0E-24
sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 50 506 5.0E-24
sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens GN=SLC2A7 PE=2 SV=2 116 511 5.0E-24
sp|Q9BYW1|GTR11_HUMAN Solute carrier family 2, facilitated glucose transporter member 11 OS=Homo sapiens GN=SLC2A11 PE=2 SV=1 91 511 6.0E-24
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 48 506 6.0E-24
sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT5 PE=1 SV=1 53 506 6.0E-24
sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 27 506 7.0E-24
sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT8 PE=1 SV=1 53 506 7.0E-24
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucose transporter member 5 OS=Bos taurus GN=SLC2A5 PE=1 SV=2 91 511 1.0E-23
sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 97 506 1.0E-23
sp|O04036|ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3 58 510 1.0E-23
sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 91 506 2.0E-23
sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 41 506 2.0E-23
sp|A4ZYQ5|GTR7_RAT Solute carrier family 2, facilitated glucose transporter member 7 OS=Rattus norvegicus GN=Slc2a7 PE=2 SV=1 116 511 2.0E-23
sp|P15325|QUTD_EMENI Quinate permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutD PE=1 SV=2 47 527 2.0E-23
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 110 506 3.0E-23
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 110 506 3.0E-23
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 91 511 5.0E-23
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 53 526 5.0E-23
sp|Q9SCW7|ERDL1_ARATH Sugar transporter ERD6-like 1 OS=Arabidopsis thaliana GN=SUGTL4 PE=2 SV=2 53 511 6.0E-23
sp|Q5RB09|GTR9_PONAB Solute carrier family 2, facilitated glucose transporter member 9 OS=Pongo abelii GN=SLC2A9 PE=2 SV=1 99 511 7.0E-23
sp|A9ZSY2|TRET1_APILI Facilitated trehalose transporter Tret1 OS=Apis mellifera ligustica GN=Tret1 PE=1 SV=1 23 512 7.0E-23
sp|A1Z8N1|TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster GN=Tret1-1 PE=1 SV=1 91 506 8.0E-23
sp|B4MYA4|TRET1_DROWI Facilitated trehalose transporter Tret1 OS=Drosophila willistoni GN=Tret1 PE=3 SV=1 97 506 8.0E-23
sp|Q4F7G0|ERDL2_ARATH Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1 61 511 1.0E-22
sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 PE=1 SV=1 53 508 1.0E-22
sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 PE=1 SV=2 53 508 1.0E-22
sp|Q8TFG1|GHT7_SCHPO Probable high-affinity hexose transporter ght7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght7 PE=3 SV=1 85 508 2.0E-22
sp|P32466|HXT3_YEAST Low-affinity glucose transporter HXT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT3 PE=1 SV=1 53 511 2.0E-22
sp|B4J913|TRET1_DROGR Facilitated trehalose transporter Tret1 OS=Drosophila grimshawi GN=Tret1 PE=3 SV=1 50 506 4.0E-22
sp|O74713|HGT1_CANAX High-affinity glucose transporter OS=Candida albicans GN=HGT1 PE=3 SV=1 53 505 4.0E-22
sp|P46896|GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus GN=SLC2A1 PE=2 SV=1 115 505 5.0E-22
sp|P11168|GTR2_HUMAN Solute carrier family 2, facilitated glucose transporter member 2 OS=Homo sapiens GN=SLC2A2 PE=1 SV=1 90 522 8.0E-22
sp|Q94AF9|EDL11_ARATH Sugar transporter ERD6-like 11 OS=Arabidopsis thaliana GN=At3g05165 PE=2 SV=2 73 510 8.0E-22
sp|B0XQS8|QUTD_ASPFC Probable quinate permease OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=qutD PE=3 SV=1 43 535 8.0E-22
sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 27 506 8.0E-22
sp|Q0D135|QUTD_ASPTN Probable quinate permease OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=qutD PE=3 SV=1 110 527 9.0E-22
sp|P78831|GHT5_SCHPO High-affinity glucose transporter ght5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght5 PE=1 SV=2 48 535 1.0E-21
sp|P47842|GTR3_CANLF Solute carrier family 2, facilitated glucose transporter member 3 OS=Canis lupus familiaris GN=SLC2A3 PE=2 SV=1 115 526 1.0E-21
sp|Q90592|GTR2_CHICK Solute carrier family 2, facilitated glucose transporter member 2 OS=Gallus gallus GN=SLC2A2 PE=2 SV=1 113 514 2.0E-21
sp|P12336|GTR2_RAT Solute carrier family 2, facilitated glucose transporter member 2 OS=Rattus norvegicus GN=Slc2a2 PE=2 SV=1 113 505 2.0E-21
sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 27 506 3.0E-21
sp|P47843|GTR3_SHEEP Solute carrier family 2, facilitated glucose transporter member 3 OS=Ovis aries GN=SLC2A3 PE=2 SV=1 115 505 4.0E-21
sp|Q5R608|GTR3_PONAB Solute carrier family 2, facilitated glucose transporter member 3 OS=Pongo abelii GN=SLC2A3 PE=2 SV=1 115 526 4.0E-21
sp|Q0P4G6|GTR10_XENTR Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus tropicalis GN=slc2a10 PE=2 SV=1 51 401 5.0E-21
sp|P42833|HXT14_YEAST Hexose transporter HXT14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT14 PE=1 SV=2 22 508 5.0E-21
sp|P11167|GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus GN=Slc2a1 PE=1 SV=1 115 507 5.0E-21
sp|Q9P3U7|GHT8_SCHPO Probable high-affinity hexose transporter ght8, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght8 PE=1 SV=1 48 506 6.0E-21
sp|P17809|GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus GN=Slc2a1 PE=1 SV=4 115 507 6.0E-21
sp|P58352|GTR3_BOVIN Solute carrier family 2, facilitated glucose transporter member 3 OS=Bos taurus GN=SLC2A3 PE=2 SV=1 115 526 6.0E-21
sp|P11169|GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens GN=SLC2A3 PE=1 SV=1 115 526 7.0E-21
sp|P21906|GLF_ZYMMO Glucose facilitated diffusion protein OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glf PE=3 SV=2 54 506 8.0E-21
sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus GN=Slc2a2 PE=1 SV=3 113 505 1.0E-20
sp|Q8TDB8|GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens GN=SLC2A14 PE=2 SV=1 115 524 2.0E-20
sp|Q6GN01|GTR10_XENLA Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus laevis GN=slc2a10 PE=2 SV=1 48 401 2.0E-20
sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens GN=SLC2A1 PE=1 SV=2 115 507 3.0E-20
sp|Q9LTP6|EDL13_ARATH Putative sugar transporter ERD6-like 13 OS=Arabidopsis thaliana GN=At3g20460 PE=3 SV=2 6 511 4.0E-20
sp|Q04162|YD387_YEAST Probable metabolite transport protein YDR387C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR387C PE=1 SV=1 51 275 5.0E-20
sp|Q5RET7|GTR5_PONAB Solute carrier family 2, facilitated glucose transporter member 5 OS=Pongo abelii GN=SLC2A5 PE=2 SV=1 91 531 8.0E-20
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 115 505 1.0E-19
sp|P13355|GTR1_RABIT Solute carrier family 2, facilitated glucose transporter member 1 OS=Oryctolagus cuniculus GN=SLC2A1 PE=2 SV=1 115 507 1.0E-19
sp|Q07647|GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus GN=Slc2a3 PE=1 SV=1 115 505 1.0E-19
sp|Q9WV38|GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus GN=Slc2a5 PE=1 SV=2 91 510 2.0E-19
sp|Q27994|GTR4_BOVIN Solute carrier family 2, facilitated glucose transporter member 4 OS=Bos taurus GN=SLC2A4 PE=2 SV=2 101 511 3.0E-19
sp|P18631|RAG1_KLULA Low-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG1 PE=1 SV=1 10 511 4.0E-19
sp|P20303|GTR1_PIG Solute carrier family 2, facilitated glucose transporter member 1 OS=Sus scrofa GN=SLC2A1 PE=2 SV=2 115 507 4.0E-19
sp|A1CPX0|QUTD_ASPCL Probable quinate permease OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=qutD PE=3 SV=1 110 535 4.0E-19
sp|O44616|FGTH1_CAEEL Facilitated glucose transporter homolog OS=Caenorhabditis elegans GN=R09B5.11 PE=1 SV=2 113 510 7.0E-19
sp|P43427|GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus GN=Slc2a5 PE=1 SV=1 91 511 1.0E-18
sp|Q94KE0|ERDL3_ARATH Sugar transporter ERD6-like 3 OS=Arabidopsis thaliana GN=SUGTL2 PE=2 SV=1 81 510 1.0E-18
sp|P27674|GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus GN=SLC2A1 PE=1 SV=1 115 507 1.0E-18
sp|P79365|GTR1_SHEEP Solute carrier family 2, facilitated glucose transporter member 1 (Fragment) OS=Ovis aries GN=SLC2A1 PE=2 SV=1 152 507 2.0E-18
sp|Q9P3U6|GHT1_SCHPO High-affinity glucose transporter ght1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght1 PE=1 SV=1 48 533 2.0E-18
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 54 262 2.0E-18
sp|Q9XSC2|GTR3_RABIT Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Oryctolagus cuniculus GN=SLC2A3 PE=2 SV=1 152 505 3.0E-18
sp|P32037|GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus GN=Slc2a3 PE=1 SV=1 115 505 3.0E-18
sp|Q7PIR5|TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae GN=Tret1 PE=1 SV=3 50 506 4.0E-18
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 53 282 6.0E-18
sp|Q8VZT3|EDL12_ARATH Sugar transporter ERD6-like 12 OS=Arabidopsis thaliana GN=SUGTL5 PE=2 SV=1 81 506 6.0E-18
sp|Q2V4B9|PLST3_ARATH Probable plastidic glucose transporter 3 OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2 55 513 2.0E-17
sp|P46408|GTR5_RABIT Solute carrier family 2, facilitated glucose transporter member 5 OS=Oryctolagus cuniculus GN=SLC2A5 PE=2 SV=1 91 505 4.0E-17
sp|P22732|GTR5_HUMAN Solute carrier family 2, facilitated glucose transporter member 5 OS=Homo sapiens GN=SLC2A5 PE=1 SV=1 91 531 6.0E-17
sp|P58351|GTR2_BOVIN Solute carrier family 2, facilitated glucose transporter member 2 OS=Bos taurus GN=SLC2A2 PE=2 SV=2 113 373 1.0E-16
sp|P19357|GTR4_RAT Solute carrier family 2, facilitated glucose transporter member 4 OS=Rattus norvegicus GN=Slc2a4 PE=1 SV=1 101 527 1.0E-16
sp|P14672|GTR4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 OS=Homo sapiens GN=SLC2A4 PE=1 SV=1 101 527 1.0E-16
sp|P14142|GTR4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus GN=Slc2a4 PE=1 SV=3 101 527 4.0E-16
sp|O44827|FGT1_CAEEL Facilitated glucose transporter protein 1 OS=Caenorhabditis elegans GN=fgt-1 PE=1 SV=2 152 511 5.0E-16
sp|P58354|GTR8_BOVIN Solute carrier family 2, facilitated glucose transporter member 8 OS=Bos taurus GN=SLC2A8 PE=2 SV=2 116 505 9.0E-16
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 61 262 1.0E-15
sp|Q9NY64|GTR8_HUMAN Solute carrier family 2, facilitated glucose transporter member 8 OS=Homo sapiens GN=SLC2A8 PE=1 SV=3 116 505 2.0E-15
sp|Q863Y9|GTR5_HORSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Equus caballus GN=SLC2A5 PE=2 SV=1 91 531 2.0E-15
sp|Q9FYG3|PLST2_ARATH Probable plastidic glucose transporter 2 OS=Arabidopsis thaliana GN=At1g67300 PE=2 SV=1 30 512 1.0E-14
sp|Q9JJZ1|GTR8_RAT Solute carrier family 2, facilitated glucose transporter member 8 OS=Rattus norvegicus GN=Slc2a8 PE=1 SV=1 54 505 2.0E-14
sp|Q9JIF3|GTR8_MOUSE Solute carrier family 2, facilitated glucose transporter member 8 OS=Mus musculus GN=Slc2a8 PE=1 SV=2 47 505 2.0E-14
sp|O95528|GTR10_HUMAN Solute carrier family 2, facilitated glucose transporter member 10 OS=Homo sapiens GN=SLC2A10 PE=1 SV=2 53 412 2.0E-13
sp|P53142|VPS73_YEAST Vacuolar protein sorting-associated protein 73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS73 PE=1 SV=1 81 498 8.0E-12
sp|Q7XA64|ERDL9_ARATH Sugar transporter ERD6-like 9 OS=Arabidopsis thaliana GN=At3g05155 PE=2 SV=1 81 373 3.0E-11
sp|P07921|LACP_KLULA Lactose permease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC12 PE=3 SV=1 92 513 3.0E-11
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 41 511 2.0E-10
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 49 504 2.0E-10
sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 49 504 2.0E-10
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 49 504 2.0E-10
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 49 504 3.0E-10
sp|O02713|S22A2_PIG Solute carrier family 22 member 2 OS=Sus scrofa GN=SLC22A2 PE=2 SV=1 85 526 5.0E-10
sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 17 263 1.0E-09
sp|Q9Y226|S22AD_HUMAN Solute carrier family 22 member 13 OS=Homo sapiens GN=SLC22A13 PE=2 SV=2 85 444 1.0E-09
sp|Q9R0W2|S22A2_RAT Solute carrier family 22 member 2 OS=Rattus norvegicus GN=Slc22a2 PE=1 SV=1 87 532 2.0E-09
sp|P43562|YFE0_YEAST Probable metabolite transport protein YFL040W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL040W PE=1 SV=1 89 506 2.0E-09
sp|Q8VHD6|GTR10_MOUSE Solute carrier family 2, facilitated glucose transporter member 10 OS=Mus musculus GN=Slc2a10 PE=2 SV=1 53 373 2.0E-09
sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 49 504 2.0E-09
sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 46 263 2.0E-09
sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=1 SV=1 46 263 3.0E-09
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 24 502 1.0E-08
sp|Q63089|S22A1_RAT Solute carrier family 22 member 1 OS=Rattus norvegicus GN=Slc22a1 PE=1 SV=1 91 520 1.0E-08
sp|O08966|S22A1_MOUSE Solute carrier family 22 member 1 OS=Mus musculus GN=Slc22a1 PE=1 SV=2 91 520 1.0E-08
sp|Q6GN01|GTR10_XENLA Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus laevis GN=slc2a10 PE=2 SV=1 426 526 2.0E-08
sp|Q66J54|S226A_XENLA Solute carrier family 22 member 6-A OS=Xenopus laevis GN=slc22a6-a PE=2 SV=1 100 530 2.0E-08
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 410 510 2.0E-07
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 410 511 2.0E-07
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 410 511 2.0E-07
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 296 510 2.0E-07
sp|A7MBE0|S22A1_BOVIN Solute carrier family 22 member 1 OS=Bos taurus GN=SLC22A1 PE=2 SV=1 87 504 2.0E-07
sp|Q12407|YD199_YEAST Putative metabolite transport protein YDL199C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL199C PE=1 SV=1 22 436 2.0E-07
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 49 526 3.0E-07
sp|O77504|S22A1_RABIT Solute carrier family 22 member 1 OS=Oryctolagus cuniculus GN=SLC22A1 PE=1 SV=1 69 504 4.0E-07
sp|Q0P4G6|GTR10_XENTR Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus tropicalis GN=slc2a10 PE=2 SV=1 426 524 6.0E-07
sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1 81 263 6.0E-07
sp|Q5R4L9|SV2A_PONAB Synaptic vesicle glycoprotein 2A OS=Pongo abelii GN=SV2A PE=2 SV=1 81 263 7.0E-07
sp|Q9JIS5|SV2A_MOUSE Synaptic vesicle glycoprotein 2A OS=Mus musculus GN=Sv2a PE=1 SV=1 81 263 7.0E-07
sp|Q02563|SV2A_RAT Synaptic vesicle glycoprotein 2A OS=Rattus norvegicus GN=Sv2a PE=1 SV=2 81 263 7.0E-07
sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 81 263 7.0E-07
sp|Q29397|SV2A_BOVIN Synaptic vesicle glycoprotein 2A OS=Bos taurus GN=SV2A PE=2 SV=1 81 263 8.0E-07
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 303 510 2.0E-06
sp|Q5EXK5|MHBT_KLEOX 3-hydroxybenzoate transporter MhbT OS=Klebsiella oxytoca GN=mhbT PE=1 SV=1 110 450 2.0E-06
sp|O62787|GTR3_PIG Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Sus scrofa GN=SLC2A3 PE=2 SV=1 157 255 2.0E-06
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 410 515 5.0E-06
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 303 505 6.0E-06
sp|A9MNY7|NANT_SALAR Putative sialic acid transporter OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=nanT PE=3 SV=1 44 217 7.0E-06
sp|Q9VCA2|ORCT_DROME Organic cation transporter protein OS=Drosophila melanogaster GN=Orct PE=1 SV=1 137 460 7.0E-06
sp|P13865|PRO1_LEIEN Probable transport protein OS=Leishmania enriettii GN=PRO-1 PE=2 SV=1 84 494 9.0E-06
sp|B5BGP4|NANT_SALPK Putative sialic acid transporter OS=Salmonella paratyphi A (strain AKU_12601) GN=nanT PE=3 SV=1 44 217 9.0E-06
sp|Q5PLF0|NANT_SALPA Putative sialic acid transporter OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nanT PE=3 SV=1 44 217 9.0E-06
sp|B4TWI9|NANT_SALSV Putative sialic acid transporter OS=Salmonella schwarzengrund (strain CVM19633) GN=nanT PE=3 SV=1 44 217 9.0E-06
sp|P0A2G5|NANT_SALTY Putative sialic acid transporter OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nanT PE=3 SV=1 44 217 1.0E-05
sp|P0A2G6|NANT_SALTI Putative sialic acid transporter OS=Salmonella typhi GN=nanT PE=3 SV=1 44 217 1.0E-05
sp|A9N832|NANT_SALPB Putative sialic acid transporter OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=nanT PE=3 SV=1 44 217 1.0E-05
sp|B4T749|NANT_SALNS Putative sialic acid transporter OS=Salmonella newport (strain SL254) GN=nanT PE=3 SV=1 44 217 1.0E-05
sp|B5RET6|NANT_SALG2 Putative sialic acid transporter OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=nanT PE=3 SV=1 44 217 1.0E-05
sp|B5R0L1|NANT_SALEP Putative sialic acid transporter OS=Salmonella enteritidis PT4 (strain P125109) GN=nanT PE=3 SV=1 44 217 1.0E-05
sp|B5FIR7|NANT_SALDC Putative sialic acid transporter OS=Salmonella dublin (strain CT_02021853) GN=nanT PE=3 SV=1 44 217 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.5

Transmembrane Domains

Domain # Start End Length
1 50 72 22
2 92 109 17
3 121 143 22
4 153 175 22
5 188 210 22
6 215 237 22
7 308 330 22
8 345 367 22
9 374 396 22
10 409 431 22
11 438 460 22
12 470 492 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|655
MVEKLDLQTVEVAHASEVNALIDDMERQLDASGGLETGIFHLRFTHPRHFTWLLVAFASMGGLLSGLDQSLISGA
NLYLPKDLGLSDRENSLVNSGMPLGAVGGALLLSPANEYFGRKGAILISIILYTVGAALEAGSINFGQFRAAPFR
TMIVAARVILGLGVGLEGGTVPVYVAETVERGIRGNLVSLYQFNIALGEVLGYAVAAMFLKVPGNWRYILGSSLL
FSTVMFVGMLFLPESPRYLMHKGKRLDSFKVWKRIRGTVSSESRLEYFLMAATVREDGLVGQEAKNRRFPWIDFF
TVPRARRALVYANIMVLLGQLTGINAIMYYMSVLMNQIGFDPEKANYMSLVGGGSLLMGTIPAIFYMERFGRRFW
AITMLPGFLTGLVLIGISYQIPLETHTMAVEACYLTGLIIYMGFFGSYACLTWVIPSEVYPTYLRSYGMTTSDAL
LFLASFIVTYNFTAMQDAMTRTGLTLGFYGGIALLGELYQIFLMPETKNKTLEEIETVLSRPTMDVARENYAGVK
ENLRNLSRKVFFFFFTQ
Coding >Ophio5|655
ATGGTAGAAAAGTTGGACCTGCAGACGGTCGAGGTGGCACACGCCAGCGAGGTCAACGCGCTGATTGACGACATG
GAACGGCAGCTCGATGCCAGCGGAGGCCTGGAGACGGGCATCTTCCACCTGCGGTTCACGCACCCGCGCCACTTC
ACTTGGCTGCTCGTCGCCTTCGCCAGCATGGGCGGATTGCTGTCTGGTCTCGACCAGAGCTTAATCTCCGGCGCC
AACCTCTATCTGCCCAAAGACCTCGGCCTCTCGGATCGGGAGAATAGCCTGGTCAACTCGGGCATGCCCCTGGGC
GCCGTGGGCGGTGCCTTACTGCTTTCCCCTGCGAATGAGTACTTTGGTCGGAAGGGGGCCATTCTCATCTCCATT
ATTCTCTACACCGTCGGAGCCGCTCTCGAGGCTGGCTCTATAAACTTTGGCCAGTTCCGCGCCGCCCCTTTCCGA
ACTATGATTGTAGCCGCTCGCGTCATCCTCGGTCTGGGCGTAGGTCTCGAAGGCGGAACGGTGCCCGTCTACGTC
GCCGAGACGGTCGAACGGGGAATCCGAGGCAATCTGGTGTCGCTCTACCAGTTCAACATTGCTCTGGGTGAAGTC
CTCGGATACGCCGTCGCGGCCATGTTCCTCAAGGTGCCCGGCAACTGGCGCTACATCCTGGGCTCGTCCCTGTTG
TTCTCGACCGTCATGTTCGTGGGGATGCTCTTCTTGCCCGAGAGCCCGAGATATCTCATGCACAAGGGCAAGAGG
CTGGATTCCTTCAAGGTCTGGAAGCGGATCCGAGGCACGGTCTCGTCCGAGTCTCGTCTCGAGTACTTTCTCATG
GCCGCTACGGTCCGGGAAGACGGTCTCGTAGGACAAGAGGCCAAGAACCGGCGGTTCCCCTGGATCGACTTTTTC
ACCGTCCCCCGCGCTCGTCGTGCTCTCGTCTACGCCAACATCATGGTTCTCCTGGGGCAGTTGACGGGCATCAAC
GCCATCATGTACTACATGTCCGTCCTGATGAACCAGATCGGTTTCGACCCGGAAAAGGCCAACTACATGTCCCTT
GTTGGCGGCGGATCGTTGCTCATGGGCACCATTCCGGCCATCTTTTACATGGAGAGGTTCGGTCGACGCTTCTGG
GCCATCACCATGCTGCCGGGCTTCTTGACGGGCCTCGTATTGATTGGCATATCCTATCAGATTCCGCTGGAAACG
CACACGATGGCTGTCGAGGCTTGCTACCTGACCGGCCTCATCATCTACATGGGCTTCTTTGGCTCCTATGCATGC
TTGACCTGGGTCATTCCGTCCGAGGTGTATCCGACATATCTACGGAGCTATGGGATGACGACGTCGGACGCCCTG
CTCTTCTTGGCATCCTTCATCGTCACCTACAACTTCACGGCCATGCAAGACGCCATGACCCGGACAGGCCTGACG
CTCGGCTTCTACGGCGGCATCGCCTTACTGGGAGAGCTGTACCAGATCTTCCTCATGCCCGAGACCAAGAACAAG
ACGCTCGAGGAAATCGAGACGGTGCTATCGCGGCCGACCATGGACGTCGCTCGAGAAAATTACGCCGGCGTCAAG
GAAAACCTGAGGAATCTATCCCGCAAAGTCTTCTTCTTCTTCTTCACGCAG
Transcript >Ophio5|655
ATGGTAGAAAAGTTGGACCTGCAGACGGTCGAGGTGGCACACGCCAGCGAGGTCAACGCGCTGATTGACGACATG
GAACGGCAGCTCGATGCCAGCGGAGGCCTGGAGACGGGCATCTTCCACCTGCGGTTCACGCACCCGCGCCACTTC
ACTTGGCTGCTCGTCGCCTTCGCCAGCATGGGCGGATTGCTGTCTGGTCTCGACCAGAGCTTAATCTCCGGCGCC
AACCTCTATCTGCCCAAAGACCTCGGCCTCTCGGATCGGGAGAATAGCCTGGTCAACTCGGGCATGCCCCTGGGC
GCCGTGGGCGGTGCCTTACTGCTTTCCCCTGCGAATGAGTACTTTGGTCGGAAGGGGGCCATTCTCATCTCCATT
ATTCTCTACACCGTCGGAGCCGCTCTCGAGGCTGGCTCTATAAACTTTGGCCAGTTCCGCGCCGCCCCTTTCCGA
ACTATGATTGTAGCCGCTCGCGTCATCCTCGGTCTGGGCGTAGGTCTCGAAGGCGGAACGGTGCCCGTCTACGTC
GCCGAGACGGTCGAACGGGGAATCCGAGGCAATCTGGTGTCGCTCTACCAGTTCAACATTGCTCTGGGTGAAGTC
CTCGGATACGCCGTCGCGGCCATGTTCCTCAAGGTGCCCGGCAACTGGCGCTACATCCTGGGCTCGTCCCTGTTG
TTCTCGACCGTCATGTTCGTGGGGATGCTCTTCTTGCCCGAGAGCCCGAGATATCTCATGCACAAGGGCAAGAGG
CTGGATTCCTTCAAGGTCTGGAAGCGGATCCGAGGCACGGTCTCGTCCGAGTCTCGTCTCGAGTACTTTCTCATG
GCCGCTACGGTCCGGGAAGACGGTCTCGTAGGACAAGAGGCCAAGAACCGGCGGTTCCCCTGGATCGACTTTTTC
ACCGTCCCCCGCGCTCGTCGTGCTCTCGTCTACGCCAACATCATGGTTCTCCTGGGGCAGTTGACGGGCATCAAC
GCCATCATGTACTACATGTCCGTCCTGATGAACCAGATCGGTTTCGACCCGGAAAAGGCCAACTACATGTCCCTT
GTTGGCGGCGGATCGTTGCTCATGGGCACCATTCCGGCCATCTTTTACATGGAGAGGTTCGGTCGACGCTTCTGG
GCCATCACCATGCTGCCGGGCTTCTTGACGGGCCTCGTATTGATTGGCATATCCTATCAGATTCCGCTGGAAACG
CACACGATGGCTGTCGAGGCTTGCTACCTGACCGGCCTCATCATCTACATGGGCTTCTTTGGCTCCTATGCATGC
TTGACCTGGGTCATTCCGTCCGAGGTGTATCCGACATATCTACGGAGCTATGGGATGACGACGTCGGACGCCCTG
CTCTTCTTGGCATCCTTCATCGTCACCTACAACTTCACGGCCATGCAAGACGCCATGACCCGGACAGGCCTGACG
CTCGGCTTCTACGGCGGCATCGCCTTACTGGGAGAGCTGTACCAGATCTTCCTCATGCCCGAGACCAAGAACAAG
ACGCTCGAGGAAATCGAGACGGTGCTATCGCGGCCGACCATGGACGTCGCTCGAGAAAATTACGCCGGCGTCAAG
GAAAACCTGAGGAATCTATCCCGCAAAGTCTTCTTCTTCTTCTTCACGCAGTAA
Gene >Ophio5|655
ATGGTAGAAAAGTTGGACCTGCAGACGGTCGAGGTGGCACACGCCAGCGAGGTCAACGCGCTGATTGACGACATG
GAACGGCAGCTCGATGCCAGCGGAGGCCTGGAGACGGGCATCTTCCACCTGCGGTTCACGCACCCGCGCCACTTC
ACTTGGCTGCTCGTCGCCTTCGCCAGCATGGGCGGATTGCTGTCTGGTCTCGACCAGAGCTTAATCTCCGGCGCC
AACCTCTATCTGCCCAAAGACCTCGGCCTCTCGGATCGGGAGAATAGCCTGGTCAACTCGGGCATGCCCCTGGGC
GCCGTGGGCGGTGCCTTACTGCTTTCCCCTGCGAATGAGTACTTTGGTCGGAAGGGGGCCATTCTCATCTCCATT
ATTCTCTACACCGTCGGAGCCGCTCTCGAGGCTGGCTCTATAAACTTTGGCCAGTTCCGCGCCGCCCCTTTCCGA
AGTCTTCCTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTAATGCGAGCACAGCTATGATTGTAGCCGCTCGCGTCA
TCCTCGGTCTGGGCGTAGGTCTCGAAGGCGGAACGGTGCCCGTCTACGTCGCCGAGACGGTCGAACGGGGAATCC
GAGGCAATCTGGTGTCGCTCTACCAGTTCAACATTGCTCTGGGTGAAGTCCTCGGATACGCCGTCGCGGCCATGT
TCCTCAAGGTGCCCGGCAACTGGCGCTACATCCTGGGCTCGTCCCTGTTGTTCTCGACCGTCATGTTCGTGGGGT
AAGATGGTGCCTCGGATACTCTCCCACTCCCCTTTTTACCTTCTTCTTCTTCTTTCTTTCTTCCTCAAAAAGCAT
CATGGATATTGACATGAAAGCCGAGGATGCTCTTCTTGCCCGAGAGCCCGAGATATCTCATGCACAAGGGCAAGA
GGCTGGATTCCTTCAAGGTCTGGAAGCGGATCCGAGGCACGGTCTCGTCCGAGTCTCGTCTCGAGTACTTTCTCA
TGGCCGCTACGGTCCGGGAAGACGGTCTCGTAGGACAAGAGGCCAAGAACCGGCGGTTCCCCTGGATCGACTTTT
TCACGTACGTCCTGCAGACGACGTTCCGTCACTCCGAGACTGATGGTTTGTTGCAGCGTCCCCCGCGCTCGTCGT
GCTCTCGTCTACGCCAACATCATGGTTCTCCTGGGGCAGTTGACGGGCATCAACGCCATCATGTACTACATGTCC
GTCCTGATGAACCAGATCGGTTTCGACCCGGAAAAGGCCAACTACATGTCCCTTGTTGGCGGCGGATCGTTGCTC
ATGGGCACCATTCCGGCCATCTTTTACATGGAGAGGTTCGGTCGACGCTTCTGGGCCATCACCATGCTGCCGGGC
TTCTTGACGGGCCTCGTATTGATTGGCATATCCTATCAGATTCCGCTGGAAACGCACACGATGGCTGTCGAGGCT
TGCTACCTGACCGGCCTCATCATCTACATGGGCTTCTTTGGCTCCTATGCATGCTTGACCTGGGGTGAGTGTTTG
GGGGGGCGTTTGGAGTTGAAATGAGTGCTGACGCCCCCTCTACAACGCCACGCGTGCAGTCATTCCGTCCGAGGT
GTATCCGACATATCTACGGAGCTATGGGATGACGACGTCGGACGCCCTGCTCTTCTTGGCATCCTTCATCGTCAC
CTACAACTTCACGGCCATGCAAGACGCCATGACCCGGACAGGCCTGACGCTCGGCTTCTACGGCGGCATCGCCTT
ACTGGGAGAGCTGTACCAGATCTTCCTCATGCCCGAGACCAAGAACAAGACGCTCGAGGAAATCGAGACGGTGCT
ATCGCGGCCGACCATGGACGTCGCTCGAGAAAATTACGCCGGCGTCAAGGAAAACCTGAGGAATCTATCCCGCAA
AGTCTTCTTCTTCTTCTTCACGCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail