Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6548
Gene name
Locationscaffold_58:29138..30902
Strand-
Gene length (bp)1764
Transcript length (bp)1764
Coding sequence length (bp)1761
Protein length (aa) 587

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00443 UCH Ubiquitin carboxyl-terminal hydrolase 3.1E-35 44 420

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CAQ1|UBP16_EMENI Ubiquitin carboxyl-terminal hydrolase 16 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ubp16 PE=3 SV=1 2 586 3.0E-164
sp|Q02863|UBP16_YEAST Ubiquitin carboxyl-terminal hydrolase 16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP16 PE=1 SV=1 12 416 7.0E-28
sp|Q9QZL6|UBP21_MOUSE Ubiquitin carboxyl-terminal hydrolase 21 OS=Mus musculus GN=Usp21 PE=1 SV=1 44 428 1.0E-18
sp|B2GUX4|UBP21_RAT Ubiquitin carboxyl-terminal hydrolase 21 OS=Rattus norvegicus GN=Usp21 PE=2 SV=1 44 428 7.0E-18
sp|Q9UK80|UBP21_HUMAN Ubiquitin carboxyl-terminal hydrolase 21 OS=Homo sapiens GN=USP21 PE=1 SV=1 44 428 1.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CAQ1|UBP16_EMENI Ubiquitin carboxyl-terminal hydrolase 16 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ubp16 PE=3 SV=1 2 586 3.0E-164
sp|Q02863|UBP16_YEAST Ubiquitin carboxyl-terminal hydrolase 16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP16 PE=1 SV=1 12 416 7.0E-28
sp|Q9QZL6|UBP21_MOUSE Ubiquitin carboxyl-terminal hydrolase 21 OS=Mus musculus GN=Usp21 PE=1 SV=1 44 428 1.0E-18
sp|B2GUX4|UBP21_RAT Ubiquitin carboxyl-terminal hydrolase 21 OS=Rattus norvegicus GN=Usp21 PE=2 SV=1 44 428 7.0E-18
sp|Q9UK80|UBP21_HUMAN Ubiquitin carboxyl-terminal hydrolase 21 OS=Homo sapiens GN=USP21 PE=1 SV=1 44 428 1.0E-17
sp|Q2KJ72|UBP21_BOVIN Ubiquitin carboxyl-terminal hydrolase 21 OS=Bos taurus GN=USP21 PE=2 SV=1 44 428 5.0E-17
sp|P36026|UBP11_YEAST Ubiquitin carboxyl-terminal hydrolase 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP11 PE=3 SV=1 29 417 4.0E-13
sp|P40818|UBP8_HUMAN Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens GN=USP8 PE=1 SV=1 14 411 8.0E-12
sp|Q80U87|UBP8_MOUSE Ubiquitin carboxyl-terminal hydrolase 8 OS=Mus musculus GN=Usp8 PE=1 SV=2 14 411 2.0E-11
sp|Q9HFS7|UBP4_KLULA Ubiquitin carboxyl-terminal hydrolase 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DOA4 PE=3 SV=1 44 411 7.0E-11
sp|Q70CQ3|UBP30_HUMAN Ubiquitin carboxyl-terminal hydrolase 30 OS=Homo sapiens GN=USP30 PE=1 SV=1 26 584 1.0E-09
sp|Q9FPS0|UBP27_ARATH Ubiquitin carboxyl-terminal hydrolase 27 OS=Arabidopsis thaliana GN=UBP27 PE=2 SV=1 45 412 6.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0004843 cysteine-type deubiquitinase activity Yes
GO:0016579 protein deubiquitination Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006508 proteolysis No
GO:0101005 deubiquitinase activity No
GO:0043412 macromolecule modification No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0008233 peptidase activity No
GO:0071704 organic substance metabolic process No
GO:0070646 protein modification by small protein removal No
GO:0016787 hydrolase activity No
GO:0070647 protein modification by small protein conjugation or removal No
GO:0019538 protein metabolic process No
GO:0036211 protein modification process No
GO:0006807 nitrogen compound metabolic process No
GO:0019783 ubiquitin-like protein peptidase activity No
GO:0003824 catalytic activity No
GO:0008234 cysteine-type peptidase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 55.99 30.32 81.67
CcL In ants, during behavior modification 134.86 63.92 205.79
CcD In ants, recently dead 56.49 30.74 82.24

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000535 yes
SC16a CcD 0.976658 no
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6548
MLPDRSVTVVSYAAGASLAAVALIYVFGPTFTIDNDGSRKKTIVGLRNNANDCFINSVLQALAGLGDLRAYLIRE
THRRHIEDAAVYQTLVQPEGGVKVEGWKLQGLQMGLVTQGLKDMLDALNERPIAKKSVTPFPFVKVLEAAFKQRI
SRQQQDAQEFLQIVAERLKDEYRAGQRARARARSRGLLPDAQGNGARGTEPAGPDQDESESEPNEGFPMEGKYES
RLMCQTCHYKTKPREEGFCTITLAVPHVQSTTLNACFDGIFKTEFIDDFKCEMCRLLQAKANLEHELSRSTSPDF
RAQAKDSIGKLGMAIETDPEQPPEDVDLGDMRYAPKRRISKTTRMTIFPKILAVHLSRSIYGVGQTTQKNSAKVA
FPERLPLGGLSEPHQYKLLGIITHRGGHNSGHYEAFRRQNQSFPYSNANTFQPSEVYSKAPTPVSTPKMKARQAG
GSPVASTTDLLSSSGPDGPTAEPPRSLPAEASSSQNAAPAERREGNGDGGSLRSVAASTKSALSKLTAPKQGQDG
GGSSSLRSLKTSQTATARRAKKRKPTSDKWWRVSDEKVRETKTSEVLGMQREVYMLFYELDD
Coding >Ophio5|6548
ATGTTGCCCGACCGGTCAGTGACGGTCGTCTCGTACGCCGCCGGCGCCTCCCTCGCCGCCGTCGCCCTCATATAC
GTCTTCGGACCGACCTTCACCATCGACAACGACGGCTCCCGCAAGAAGACCATCGTCGGTCTGCGTAACAATGCC
AACGACTGCTTCATCAACTCGGTCCTCCAGGCTCTCGCTGGACTGGGCGATCTGCGCGCCTACCTCATCCGCGAA
ACCCATCGACGGCACATCGAGGATGCCGCCGTCTACCAGACTCTGGTCCAGCCCGAGGGCGGCGTCAAGGTCGAA
GGGTGGAAGCTGCAGGGCTTGCAGATGGGCCTCGTCACCCAGGGACTCAAGGACATGTTGGATGCGCTTAATGAG
CGACCCATTGCCAAGAAGTCTGTGACGCCCTTTCCTTTTGTCAAGGTGCTCGAGGCCGCCTTCAAGCAGCGCATA
AGTCGGCAACAGCAGGACGCCCAGGAGTTTCTTCAGATTGTCGCCGAGAGGCTCAAGGACGAATACCGCGCCGGC
CAGCGCGCACGCGCCCGCGCCCGGAGCCGAGGGCTGCTTCCTGATGCCCAAGGCAACGGGGCGCGCGGGACGGAA
CCTGCTGGTCCTGACCAGGACGAGTCCGAGTCGGAGCCGAACGAGGGTTTCCCCATGGAAGGCAAATACGAGTCT
CGCCTGATGTGCCAGACCTGCCACTACAAGACGAAGCCGAGAGAGGAGGGCTTCTGCACCATCACGCTGGCCGTG
CCGCACGTGCAGTCGACGACACTCAACGCTTGCTTCGATGGCATCTTCAAAACGGAGTTCATCGACGACTTCAAG
TGCGAAATGTGTCGCCTCCTCCAGGCCAAGGCCAACCTGGAACACGAGCTCTCCCGGTCGACGTCACCCGACTTC
CGGGCGCAGGCCAAGGACAGCATCGGAAAACTTGGCATGGCCATCGAGACGGACCCGGAGCAGCCGCCGGAGGAC
GTGGACCTGGGTGACATGCGCTACGCGCCCAAGCGGAGAATCTCCAAGACGACGCGCATGACCATCTTTCCCAAG
ATCCTCGCCGTCCACCTCTCGCGGTCCATATATGGCGTCGGACAAACGACGCAAAAGAACTCGGCCAAGGTGGCG
TTTCCGGAACGGCTGCCGCTGGGCGGGCTCTCGGAACCGCATCAGTACAAGCTGCTGGGCATCATTACCCACCGA
GGCGGCCATAACAGCGGCCACTACGAGGCGTTCCGGCGTCAGAACCAGTCGTTTCCGTATTCCAACGCAAACACT
TTTCAGCCGTCCGAGGTGTACAGCAAGGCGCCAACACCCGTGTCGACGCCCAAGATGAAGGCTCGGCAGGCCGGC
GGCAGTCCCGTCGCCTCGACGACGGACCTCCTCTCGTCGTCGGGGCCGGACGGGCCGACGGCGGAGCCTCCGCGC
AGCCTGCCGGCCGAGGCGAGCTCGTCGCAGAACGCGGCACCGGCCGAGAGGAGGGAAGGGAACGGCGACGGGGGC
AGCCTGCGATCCGTGGCCGCGTCCACCAAGTCGGCCCTGTCCAAGCTGACGGCGCCCAAACAAGGGCAGGACGGC
GGCGGCTCGTCATCCCTGAGAAGCCTCAAGACATCGCAAACGGCGACGGCTCGTCGGGCCAAGAAGCGCAAGCCG
ACGTCGGACAAATGGTGGCGCGTCAGCGACGAAAAAGTGCGCGAGACCAAGACGAGCGAGGTGCTGGGCATGCAA
CGGGAGGTGTACATGCTATTCTACGAGTTGGATGAT
Transcript >Ophio5|6548
ATGTTGCCCGACCGGTCAGTGACGGTCGTCTCGTACGCCGCCGGCGCCTCCCTCGCCGCCGTCGCCCTCATATAC
GTCTTCGGACCGACCTTCACCATCGACAACGACGGCTCCCGCAAGAAGACCATCGTCGGTCTGCGTAACAATGCC
AACGACTGCTTCATCAACTCGGTCCTCCAGGCTCTCGCTGGACTGGGCGATCTGCGCGCCTACCTCATCCGCGAA
ACCCATCGACGGCACATCGAGGATGCCGCCGTCTACCAGACTCTGGTCCAGCCCGAGGGCGGCGTCAAGGTCGAA
GGGTGGAAGCTGCAGGGCTTGCAGATGGGCCTCGTCACCCAGGGACTCAAGGACATGTTGGATGCGCTTAATGAG
CGACCCATTGCCAAGAAGTCTGTGACGCCCTTTCCTTTTGTCAAGGTGCTCGAGGCCGCCTTCAAGCAGCGCATA
AGTCGGCAACAGCAGGACGCCCAGGAGTTTCTTCAGATTGTCGCCGAGAGGCTCAAGGACGAATACCGCGCCGGC
CAGCGCGCACGCGCCCGCGCCCGGAGCCGAGGGCTGCTTCCTGATGCCCAAGGCAACGGGGCGCGCGGGACGGAA
CCTGCTGGTCCTGACCAGGACGAGTCCGAGTCGGAGCCGAACGAGGGTTTCCCCATGGAAGGCAAATACGAGTCT
CGCCTGATGTGCCAGACCTGCCACTACAAGACGAAGCCGAGAGAGGAGGGCTTCTGCACCATCACGCTGGCCGTG
CCGCACGTGCAGTCGACGACACTCAACGCTTGCTTCGATGGCATCTTCAAAACGGAGTTCATCGACGACTTCAAG
TGCGAAATGTGTCGCCTCCTCCAGGCCAAGGCCAACCTGGAACACGAGCTCTCCCGGTCGACGTCACCCGACTTC
CGGGCGCAGGCCAAGGACAGCATCGGAAAACTTGGCATGGCCATCGAGACGGACCCGGAGCAGCCGCCGGAGGAC
GTGGACCTGGGTGACATGCGCTACGCGCCCAAGCGGAGAATCTCCAAGACGACGCGCATGACCATCTTTCCCAAG
ATCCTCGCCGTCCACCTCTCGCGGTCCATATATGGCGTCGGACAAACGACGCAAAAGAACTCGGCCAAGGTGGCG
TTTCCGGAACGGCTGCCGCTGGGCGGGCTCTCGGAACCGCATCAGTACAAGCTGCTGGGCATCATTACCCACCGA
GGCGGCCATAACAGCGGCCACTACGAGGCGTTCCGGCGTCAGAACCAGTCGTTTCCGTATTCCAACGCAAACACT
TTTCAGCCGTCCGAGGTGTACAGCAAGGCGCCAACACCCGTGTCGACGCCCAAGATGAAGGCTCGGCAGGCCGGC
GGCAGTCCCGTCGCCTCGACGACGGACCTCCTCTCGTCGTCGGGGCCGGACGGGCCGACGGCGGAGCCTCCGCGC
AGCCTGCCGGCCGAGGCGAGCTCGTCGCAGAACGCGGCACCGGCCGAGAGGAGGGAAGGGAACGGCGACGGGGGC
AGCCTGCGATCCGTGGCCGCGTCCACCAAGTCGGCCCTGTCCAAGCTGACGGCGCCCAAACAAGGGCAGGACGGC
GGCGGCTCGTCATCCCTGAGAAGCCTCAAGACATCGCAAACGGCGACGGCTCGTCGGGCCAAGAAGCGCAAGCCG
ACGTCGGACAAATGGTGGCGCGTCAGCGACGAAAAAGTGCGCGAGACCAAGACGAGCGAGGTGCTGGGCATGCAA
CGGGAGGTGTACATGCTATTCTACGAGTTGGATGATTAG
Gene >Ophio5|6548
ATGTTGCCCGACCGGTCAGTGACGGTCGTCTCGTACGCCGCCGGCGCCTCCCTCGCCGCCGTCGCCCTCATATAC
GTCTTCGGACCGACCTTCACCATCGACAACGACGGCTCCCGCAAGAAGACCATCGTCGGTCTGCGTAACAATGCC
AACGACTGCTTCATCAACTCGGTCCTCCAGGCTCTCGCTGGACTGGGCGATCTGCGCGCCTACCTCATCCGCGAA
ACCCATCGACGGCACATCGAGGATGCCGCCGTCTACCAGACTCTGGTCCAGCCCGAGGGCGGCGTCAAGGTCGAA
GGGTGGAAGCTGCAGGGCTTGCAGATGGGCCTCGTCACCCAGGGACTCAAGGACATGTTGGATGCGCTTAATGAG
CGACCCATTGCCAAGAAGTCTGTGACGCCCTTTCCTTTTGTCAAGGTGCTCGAGGCCGCCTTCAAGCAGCGCATA
AGTCGGCAACAGCAGGACGCCCAGGAGTTTCTTCAGATTGTCGCCGAGAGGCTCAAGGACGAATACCGCGCCGGC
CAGCGCGCACGCGCCCGCGCCCGGAGCCGAGGGCTGCTTCCTGATGCCCAAGGCAACGGGGCGCGCGGGACGGAA
CCTGCTGGTCCTGACCAGGACGAGTCCGAGTCGGAGCCGAACGAGGGTTTCCCCATGGAAGGCAAATACGAGTCT
CGCCTGATGTGCCAGACCTGCCACTACAAGACGAAGCCGAGAGAGGAGGGCTTCTGCACCATCACGCTGGCCGTG
CCGCACGTGCAGTCGACGACACTCAACGCTTGCTTCGATGGCATCTTCAAAACGGAGTTCATCGACGACTTCAAG
TGCGAAATGTGTCGCCTCCTCCAGGCCAAGGCCAACCTGGAACACGAGCTCTCCCGGTCGACGTCACCCGACTTC
CGGGCGCAGGCCAAGGACAGCATCGGAAAACTTGGCATGGCCATCGAGACGGACCCGGAGCAGCCGCCGGAGGAC
GTGGACCTGGGTGACATGCGCTACGCGCCCAAGCGGAGAATCTCCAAGACGACGCGCATGACCATCTTTCCCAAG
ATCCTCGCCGTCCACCTCTCGCGGTCCATATATGGCGTCGGACAAACGACGCAAAAGAACTCGGCCAAGGTGGCG
TTTCCGGAACGGCTGCCGCTGGGCGGGCTCTCGGAACCGCATCAGTACAAGCTGCTGGGCATCATTACCCACCGA
GGCGGCCATAACAGCGGCCACTACGAGGCGTTCCGGCGTCAGAACCAGTCGTTTCCGTATTCCAACGCAAACACT
TTTCAGCCGTCCGAGGTGTACAGCAAGGCGCCAACACCCGTGTCGACGCCCAAGATGAAGGCTCGGCAGGCCGGC
GGCAGTCCCGTCGCCTCGACGACGGACCTCCTCTCGTCGTCGGGGCCGGACGGGCCGACGGCGGAGCCTCCGCGC
AGCCTGCCGGCCGAGGCGAGCTCGTCGCAGAACGCGGCACCGGCCGAGAGGAGGGAAGGGAACGGCGACGGGGGC
AGCCTGCGATCCGTGGCCGCGTCCACCAAGTCGGCCCTGTCCAAGCTGACGGCGCCCAAACAAGGGCAGGACGGC
GGCGGCTCGTCATCCCTGAGAAGCCTCAAGACATCGCAAACGGCGACGGCTCGTCGGGCCAAGAAGCGCAAGCCG
ACGTCGGACAAATGGTGGCGCGTCAGCGACGAAAAAGTGCGCGAGACCAAGACGAGCGAGGTGCTGGGCATGCAA
CGGGAGGTGTACATGCTATTCTACGAGTTGGATGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail