Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|654
Gene name
Locationscaffold_1177:2059..2483
Strand-
Gene length (bp)424
Transcript length (bp)339
Coding sequence length (bp)336
Protein length (aa) 112

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.5

Transmembrane Domains

Domain # Start End Length
1 32 51 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 20.61 4.00 37.21
CcL In ants, during behavior modification 154.11 70.79 237.43
CcD In ants, recently dead 97.20 39.16 155.25

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.105003 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|654
MRALFEKPLGSRASPSAILSHMLLPSLPRRRLAIASLFVVGLFFACFRLAARCGESDGPYCGIGSLRRSDDAFLP
TTPPPPPPPGADTDADADANRSAKPDAQAASRESSPT
Coding >Ophio5|654
ATGCGCGCCCTCTTCGAAAAGCCCCTCGGCAGCCGAGCCTCGCCTTCGGCCATTCTCAGCCACATGTTGTTACCA
TCGCTTCCTCGCCGGCGGCTCGCCATCGCCAGCCTCTTCGTCGTCGGCCTCTTCTTCGCCTGCTTCCGGCTCGCG
GCCCGGTGCGGTGAGAGCGACGGACCATACTGCGGAATTGGCAGCCTGCGCCGGAGCGATGATGCCTTCCTCCCG
ACTACGCCGCCGCCGCCGCCGCCGCCCGGAGCCGATACCGATGCCGATGCCGATGCCAACCGTTCGGCGAAGCCC
GATGCCCAGGCCGCGTCCCGCGAATCCTCACCAACC
Transcript >Ophio5|654
ATGCGCGCCCTCTTCGAAAAGCCCCTCGGCAGCCGAGCCTCGCCTTCGGCCATTCTCAGCCACATGTTGTTACCA
TCGCTTCCTCGCCGGCGGCTCGCCATCGCCAGCCTCTTCGTCGTCGGCCTCTTCTTCGCCTGCTTCCGGCTCGCG
GCCCGGTGCGGTGAGAGCGACGGACCATACTGCGGAATTGGCAGCCTGCGCCGGAGCGATGATGCCTTCCTCCCG
ACTACGCCGCCGCCGCCGCCGCCGCCCGGAGCCGATACCGATGCCGATGCCGATGCCAACCGTTCGGCGAAGCCC
GATGCCCAGGCCGCGTCCCGCGAATCCTCACCAACCTGA
Gene >Ophio5|654
ATGCGCGCCCTCTTCGAAAAGCCCCTCGGCAGCCGAGCCTCGCCTTCGGCCATTCTCAGCCACATGTTGTTACCA
TCGCTTCCTCGCCGGCGGCTCGCCATCGCCAGCCTCTTCGTCGTCGGCCTCTTCTTCGCCTGCTTCCGGCTCGCG
GCCCGGTGCGGTGAGAGCGACGGACCATACTGCGGAATTGGCAGCCTGCGCCGGAGCGATGATGCCTTCCTCCCG
ACTACGCCGCCGCCGCCGCCGCCGCCCGGAGCCGATACCGATGCCGATGCCGATGCCAACCGTTCGGCGAAGCCC
GATGCCCAGGCCGCGTCCCGCGAGTGCGCTTCTTTCCCCGACACGTCGCGCGTCGTACTGGTGATGAAGACGGGC
GCGTCAGAAGCTTACGCCCGCATCCCGACGCAGATCCTCACCAACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail