Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6532
Gene name
Locationscaffold_578:4827..7155
Strand+
Gene length (bp)2328
Transcript length (bp)2271
Coding sequence length (bp)2268
Protein length (aa) 756

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 8.2E-08 96 133

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10563|QUTA_EMENI Quinic acid utilization activator OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutA PE=3 SV=2 84 140 2.0E-07
sp|G4MZJ4|XLNR_MAGO7 Xylanolytic transcriptional activator xlnR homolog OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=xlr1 PE=3 SV=1 81 139 1.0E-06
sp|Q0CV52|XLNR_ASPTN Xylanolytic transcriptional activator xlnR OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xlnR PE=3 SV=2 83 139 1.0E-06
sp|Q2UD93|XLNR_ASPOR Xylanolytic transcriptional activator xlnR OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xlnR PE=1 SV=2 89 139 1.0E-06
sp|B8N6M6|XLNR_ASPFN Xylanolytic transcriptional activator xlnR OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xlnR PE=3 SV=1 89 139 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10563|QUTA_EMENI Quinic acid utilization activator OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutA PE=3 SV=2 84 140 2.0E-07
sp|G4MZJ4|XLNR_MAGO7 Xylanolytic transcriptional activator xlnR homolog OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=xlr1 PE=3 SV=1 81 139 1.0E-06
sp|Q0CV52|XLNR_ASPTN Xylanolytic transcriptional activator xlnR OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xlnR PE=3 SV=2 83 139 1.0E-06
sp|Q2UD93|XLNR_ASPOR Xylanolytic transcriptional activator xlnR OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xlnR PE=1 SV=2 89 139 1.0E-06
sp|B8N6M6|XLNR_ASPFN Xylanolytic transcriptional activator xlnR OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xlnR PE=3 SV=1 89 139 1.0E-06
sp|Q5AVS0|XLNR_EMENI Xylanolytic transcriptional activator xlnR OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xlnR PE=2 SV=2 89 139 2.0E-06
sp|A1DIC0|XLNR_NEOFI Xylanolytic transcriptional activator xlnR OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xlnR PE=3 SV=2 89 139 2.0E-06
sp|B0XUL1|XLNR_ASPFC Xylanolytic transcriptional activator xlnR OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xlnR PE=3 SV=1 89 139 2.0E-06
sp|Q96WP8|XLNR_ASPKA Xylanolytic transcriptional activator xlnR OS=Aspergillus kawachii GN=xlnR PE=3 SV=2 89 139 2.0E-06
sp|O42804|XLNR_ASPNG Xylanolytic transcriptional activator xlnR OS=Aspergillus niger GN=xlnR PE=1 SV=2 89 139 2.0E-06
sp|A2R5W7|XLNR_ASPNC Xylanolytic transcriptional activator xlnR OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xlnR PE=3 SV=2 89 139 2.0E-06
sp|A2QJX5|ARAR_ASPNC Arabinanolytic transcriptional activator araR OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=araR PE=3 SV=1 70 205 4.0E-06
sp|Q4WZV6|XLNR_ASPFU Xylanolytic transcriptional activator xlnR OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xlnR PE=3 SV=1 89 139 6.0E-06
sp|A1C7P9|XLNR_ASPCL Xylanolytic transcriptional activator xlnR OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xlnR PE=3 SV=2 89 139 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0008150 biological_process No
GO:0051252 regulation of RNA metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0019222 regulation of metabolic process No
GO:0050794 regulation of cellular process No
GO:0140110 transcription regulator activity No
GO:0031323 regulation of cellular metabolic process No
GO:0065007 biological regulation No
GO:0046872 metal ion binding No
GO:0010468 regulation of gene expression No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0005488 binding No
GO:0080090 regulation of primary metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0050789 regulation of biological process No
GO:0003700 DNA-binding transcription factor activity No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0046914 transition metal ion binding No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6532
MASREQTPSPSQQVAYASNGLEMLQAASDAAQAIDNPQALHDAVAAVEAVSGPDLGSLASAEPAPSPTTSASASL
PLVPGAVRDPTINPKLTRLRRACDMCSMRKVKCDDSSIPCRPCRELGVDCTYERETKRRGPPNKHAEAAKAAKRA
RVELAVPVTAATPAAVPISAAPSSSAAASPSPHNAAKTLVSISADAAVDADALAPLPVLEHLVDDFFTYVHPLAP
FPHEPTFRQSFANREDRTRPEFLGLLASMVAALVASFPRSAREHLKAQHGPQLFPRPVAMVDRCRDVALLTRGSR
WVLKQPKTLDDAATSYFLGLASAYVGQWNASRHFLAETLTLMRELGFARPKHPGDLPTFGNDAYSDDPLPFNHVK
DQIGKRIFWCLLLGVRSFSQLGASHTPTDLVIAPSTPSLPYPAYPDNVDDICVLANQVIHQPEGSVTLLTGFRFA
IDIYTTMNGVVSLELAYGMSTLPWADQRLLLRDGLVAAKSIVDNLPPELQLGGQLTAAEDDDDDDAGLQYVPPAW
PNPQPAHDVRALIKAQPLRRRQLQLEIQRANIFVSQLATRSYFVELYFTLRDVHLSESQAEGTTATESTAAAAAA
AAAGAASSDEEKALQDADDKEMLDLMTQERDLLVQNLLTIISSLSQRNMEPNGGALISKLRRVALSLLHEAPERK
GEFAIKADEALAQLVESLSKLDSWSSSSSSSSSSSSSSDQSLMMTAEDEHVELRAWAELRDFQLRFVADAGFADL
LGGVHG
Coding >Ophio5|6532
ATGGCGAGCCGCGAACAGACGCCATCGCCATCGCAGCAAGTCGCCTACGCCAGCAACGGGCTGGAGATGCTCCAG
GCCGCCAGCGATGCTGCCCAGGCCATCGATAACCCGCAGGCTCTTCACGATGCCGTCGCCGCTGTCGAGGCCGTA
TCCGGTCCGGACCTCGGATCGTTGGCTTCGGCCGAGCCTGCTCCGTCACCGACGACTTCTGCTTCGGCATCGCTG
CCTCTCGTTCCCGGCGCCGTTCGTGATCCGACCATTAACCCGAAGCTGACACGTCTTCGCCGTGCTTGCGACATG
TGCAGTATGCGCAAGGTCAAATGCGACGACTCCAGTATCCCCTGTCGTCCATGCCGCGAACTCGGTGTCGATTGC
ACCTACGAGCGCGAGACGAAACGTCGCGGTCCGCCCAACAAGCACGCTGAAGCTGCCAAGGCGGCCAAACGCGCC
CGCGTCGAGCTCGCCGTCCCCGTTACGGCTGCCACTCCCGCTGCTGTTCCCATCTCGGCCGCTCCGTCTTCATCA
GCTGCCGCCTCACCATCGCCGCACAACGCGGCCAAGACTCTGGTCAGCATCTCGGCCGATGCCGCCGTCGACGCA
GACGCCCTCGCTCCCCTCCCTGTCCTCGAGCATCTGGTCGACGACTTCTTCACCTACGTCCATCCTCTCGCCCCC
TTCCCCCACGAGCCTACCTTTCGCCAGTCCTTTGCCAACCGCGAGGACCGCACGCGTCCCGAATTCCTCGGCCTG
CTCGCTTCCATGGTAGCAGCCCTGGTGGCATCCTTTCCGCGGAGCGCCCGCGAGCACCTCAAGGCCCAGCACGGC
CCGCAGCTCTTCCCGCGACCCGTCGCCATGGTCGATCGCTGCCGTGATGTCGCCCTTTTGACGCGCGGCAGCCGC
TGGGTGCTCAAGCAGCCCAAGACGCTGGACGACGCTGCCACGAGCTACTTCCTCGGCCTCGCCTCTGCCTACGTC
GGCCAATGGAACGCATCGCGCCATTTCCTGGCCGAGACGCTGACGCTGATGCGGGAGCTGGGTTTCGCCCGTCCC
AAGCACCCGGGCGATCTTCCGACGTTTGGAAACGACGCCTACTCGGACGACCCGCTCCCCTTTAACCACGTCAAG
GACCAGATTGGGAAGCGCATATTTTGGTGTCTGCTGCTGGGTGTCCGCTCCTTTTCCCAGCTCGGCGCGTCCCAT
ACGCCGACCGATCTCGTCATCGCCCCGTCGACGCCCAGTCTTCCCTACCCGGCCTACCCTGACAACGTCGACGAC
ATTTGCGTCTTGGCCAACCAAGTCATCCACCAGCCCGAGGGCAGCGTCACCCTCCTCACGGGCTTCCGCTTCGCA
ATCGACATCTACACTACTATGAACGGCGTCGTCAGCCTCGAACTGGCTTACGGAATGAGCACCCTCCCCTGGGCA
GATCAGCGGCTGCTGCTTCGTGACGGCCTCGTCGCCGCAAAGAGCATCGTCGACAACCTCCCTCCGGAACTCCAG
CTCGGCGGCCAGCTCACGGCCGCTGAAGACGACGACGACGACGACGCCGGCCTCCAGTACGTGCCTCCGGCCTGG
CCCAACCCGCAGCCAGCGCACGACGTCCGGGCTCTCATCAAGGCTCAACCCCTCCGCCGTCGCCAGCTCCAGCTC
GAGATCCAAAGGGCCAACATCTTCGTCTCCCAACTCGCGACGCGCTCCTACTTTGTCGAGCTATACTTTACCCTA
CGGGACGTCCACCTCAGCGAATCCCAAGCCGAGGGCACAACAGCAACGGAATCGACAGCAGCAGCAGCAGCAGCA
GCAGCAGCAGGAGCAGCATCATCAGACGAAGAGAAAGCCCTCCAAGACGCCGACGACAAGGAAATGCTAGACCTC
ATGACGCAAGAACGAGACCTCCTGGTGCAAAACCTCCTCACCATCATCAGCTCACTGTCACAACGAAACATGGAA
CCCAACGGCGGAGCGCTCATCAGCAAACTCCGTCGAGTAGCCCTGTCCCTCTTACACGAGGCGCCGGAACGGAAA
GGCGAATTCGCCATCAAGGCGGACGAGGCGCTCGCGCAGCTGGTGGAGTCGTTGAGCAAGTTGGATAGCTGGTCA
TCATCATCGTCATCGTCGTCGTCGTCGTCGTCGTCGTCGGATCAGTCGCTCATGATGACGGCCGAGGACGAGCAC
GTCGAGTTGAGGGCCTGGGCCGAGTTGAGGGATTTCCAGCTTCGCTTTGTGGCGGATGCTGGCTTTGCGGATTTG
CTGGGCGGAGTCCATGGT
Transcript >Ophio5|6532
ATGGCGAGCCGCGAACAGACGCCATCGCCATCGCAGCAAGTCGCCTACGCCAGCAACGGGCTGGAGATGCTCCAG
GCCGCCAGCGATGCTGCCCAGGCCATCGATAACCCGCAGGCTCTTCACGATGCCGTCGCCGCTGTCGAGGCCGTA
TCCGGTCCGGACCTCGGATCGTTGGCTTCGGCCGAGCCTGCTCCGTCACCGACGACTTCTGCTTCGGCATCGCTG
CCTCTCGTTCCCGGCGCCGTTCGTGATCCGACCATTAACCCGAAGCTGACACGTCTTCGCCGTGCTTGCGACATG
TGCAGTATGCGCAAGGTCAAATGCGACGACTCCAGTATCCCCTGTCGTCCATGCCGCGAACTCGGTGTCGATTGC
ACCTACGAGCGCGAGACGAAACGTCGCGGTCCGCCCAACAAGCACGCTGAAGCTGCCAAGGCGGCCAAACGCGCC
CGCGTCGAGCTCGCCGTCCCCGTTACGGCTGCCACTCCCGCTGCTGTTCCCATCTCGGCCGCTCCGTCTTCATCA
GCTGCCGCCTCACCATCGCCGCACAACGCGGCCAAGACTCTGGTCAGCATCTCGGCCGATGCCGCCGTCGACGCA
GACGCCCTCGCTCCCCTCCCTGTCCTCGAGCATCTGGTCGACGACTTCTTCACCTACGTCCATCCTCTCGCCCCC
TTCCCCCACGAGCCTACCTTTCGCCAGTCCTTTGCCAACCGCGAGGACCGCACGCGTCCCGAATTCCTCGGCCTG
CTCGCTTCCATGGTAGCAGCCCTGGTGGCATCCTTTCCGCGGAGCGCCCGCGAGCACCTCAAGGCCCAGCACGGC
CCGCAGCTCTTCCCGCGACCCGTCGCCATGGTCGATCGCTGCCGTGATGTCGCCCTTTTGACGCGCGGCAGCCGC
TGGGTGCTCAAGCAGCCCAAGACGCTGGACGACGCTGCCACGAGCTACTTCCTCGGCCTCGCCTCTGCCTACGTC
GGCCAATGGAACGCATCGCGCCATTTCCTGGCCGAGACGCTGACGCTGATGCGGGAGCTGGGTTTCGCCCGTCCC
AAGCACCCGGGCGATCTTCCGACGTTTGGAAACGACGCCTACTCGGACGACCCGCTCCCCTTTAACCACGTCAAG
GACCAGATTGGGAAGCGCATATTTTGGTGTCTGCTGCTGGGTGTCCGCTCCTTTTCCCAGCTCGGCGCGTCCCAT
ACGCCGACCGATCTCGTCATCGCCCCGTCGACGCCCAGTCTTCCCTACCCGGCCTACCCTGACAACGTCGACGAC
ATTTGCGTCTTGGCCAACCAAGTCATCCACCAGCCCGAGGGCAGCGTCACCCTCCTCACGGGCTTCCGCTTCGCA
ATCGACATCTACACTACTATGAACGGCGTCGTCAGCCTCGAACTGGCTTACGGAATGAGCACCCTCCCCTGGGCA
GATCAGCGGCTGCTGCTTCGTGACGGCCTCGTCGCCGCAAAGAGCATCGTCGACAACCTCCCTCCGGAACTCCAG
CTCGGCGGCCAGCTCACGGCCGCTGAAGACGACGACGACGACGACGCCGGCCTCCAGTACGTGCCTCCGGCCTGG
CCCAACCCGCAGCCAGCGCACGACGTCCGGGCTCTCATCAAGGCTCAACCCCTCCGCCGTCGCCAGCTCCAGCTC
GAGATCCAAAGGGCCAACATCTTCGTCTCCCAACTCGCGACGCGCTCCTACTTTGTCGAGCTATACTTTACCCTA
CGGGACGTCCACCTCAGCGAATCCCAAGCCGAGGGCACAACAGCAACGGAATCGACAGCAGCAGCAGCAGCAGCA
GCAGCAGCAGGAGCAGCATCATCAGACGAAGAGAAAGCCCTCCAAGACGCCGACGACAAGGAAATGCTAGACCTC
ATGACGCAAGAACGAGACCTCCTGGTGCAAAACCTCCTCACCATCATCAGCTCACTGTCACAACGAAACATGGAA
CCCAACGGCGGAGCGCTCATCAGCAAACTCCGTCGAGTAGCCCTGTCCCTCTTACACGAGGCGCCGGAACGGAAA
GGCGAATTCGCCATCAAGGCGGACGAGGCGCTCGCGCAGCTGGTGGAGTCGTTGAGCAAGTTGGATAGCTGGTCA
TCATCATCGTCATCGTCGTCGTCGTCGTCGTCGTCGTCGGATCAGTCGCTCATGATGACGGCCGAGGACGAGCAC
GTCGAGTTGAGGGCCTGGGCCGAGTTGAGGGATTTCCAGCTTCGCTTTGTGGCGGATGCTGGCTTTGCGGATTTG
CTGGGCGGAGTCCATGGTTGA
Gene >Ophio5|6532
ATGGCGAGCCGCGAACAGACGCCATCGCCATCGCAGCAAGTCGCCTACGCCAGCAACGGGCTGGAGATGCTCCAG
GCCGCCAGCGATGCTGCCCAGGCCATCGATAACCCGCAGGCTCTTCACGATGCCGTCGCCGCTGTCGAGGCCGTA
TCCGGTCCGGACCTCGGATCGTTGGCTTCGGCCGAGCCTGCTCCGTCACCGACGACTTCTGCTTCGGCATCGCTG
CCTCTCGTTCCCGGCGCCGTTCGTGATCCGACCATTAACCCGAAGCTGACACGTCTTCGCCGTGCTTGCGACATG
TGCAGTATGCGCAAGGTCAAATGCGACGACTCCAGTATCCCCTGTCGTCCATGCCGCGAACTCGGTGTCGATTGC
ACCTACGAGCGCGAGACGAAACGTCGCGGTCCGCCCAACAAGCACGCTGAAGCTGCCAAGGCGGCCAAACGCGCC
CGCGTCGAGCTCGCCGTCCCCGTTACGGCTGCCACTCCCGCTGCTGTTCCCATCTCGGCCGCTCCGTCTTCATCA
GCTGCCGCCTCACCATCGCCGCACAACGCGGCCAAGACTCTGGTCAGCATCTCGGCCGATGCCGCCGTCGACGCA
GACGCCCTCGCTCCCCTCCCTGTCCTCGAGCATCTGGTCGACGACTTCTTCACCTACGTCCATCCTCTCGCCCCC
TTCCCCCACGAGCCTACCTTTCGCCAGTCCTTTGCCAACCGCGAGGACCGCACGCGTCCCGAATTCCTCGGCCTG
CTCGCTTCCATGGTAGCAGCCCTGGTGGCATCCTTTCCGCGGAGCGCCCGCGAGCACCTCAAGGCCCAGCACGGC
CCGCAGCTCTTCCCGCGACCCGTCGCCATGGTCGATCGCTGCCGTGATGTCGCCCTTTTGACGCGCGGCAGCCGC
TGGGTGCTCAAGCAGCCCAAGACGCTGGACGACGCTGCCACGAGCTACTTCCTCGGCCTCGCCTCTGCCTACGTC
GGCCAATGGAACGCATCGCGCCATTTCCTGGCCGAGACGCTGACGCTGATGCGGGAGCTGGGTTTCGCCCGTCCC
AAGCACCCGGGCGATCTTCCGACGTTTGGAAACGACGCCTACTCGGACGACCCGCTCCCCTTTAACCACGTCAAG
GACCAGATTGGGAAGCGCATATTTTGGTGTCTGCTGCTGGGTGTCCGGTGGGACTTTTCTGTCCCCAACTTGGCG
GATCTCATGTCTGACGTGGTTGATGGCAGCTCCTTTTCCCAGCTCGGCGCGTCCCATACGCCGACCGATCTCGTC
ATCGCCCCGTCGACGCCCAGTCTTCCCTACCCGGCCTACCCTGACAACGTCGACGACATTTGCGTCTTGGCCAAC
CAAGTCATCCACCAGCCCGAGGGCAGCGTCACCCTCCTCACGGGCTTCCGCTTCGCAATCGACATCTACACTACT
ATGAACGGCGTCGTCAGCCTCGAACTGGCTTACGGAATGAGCACCCTCCCCTGGGCAGATCAGCGGCTGCTGCTT
CGTGACGGCCTCGTCGCCGCAAAGAGCATCGTCGACAACCTCCCTCCGGAACTCCAGCTCGGCGGCCAGCTCACG
GCCGCTGAAGACGACGACGACGACGACGCCGGCCTCCAGTACGTGCCTCCGGCCTGGCCCAACCCGCAGCCAGCG
CACGACGTCCGGGCTCTCATCAAGGCTCAACCCCTCCGCCGTCGCCAGCTCCAGCTCGAGATCCAAAGGGCCAAC
ATCTTCGTCTCCCAACTCGCGACGCGCTCCTACTTTGTCGAGCTATACTTTACCCTACGGGACGTCCACCTCAGC
GAATCCCAAGCCGAGGGCACAACAGCAACGGAATCGACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGGAGCAGCA
TCATCAGACGAAGAGAAAGCCCTCCAAGACGCCGACGACAAGGAAATGCTAGACCTCATGACGCAAGAACGAGAC
CTCCTGGTGCAAAACCTCCTCACCATCATCAGCTCACTGTCACAACGAAACATGGAACCCAACGGCGGAGCGCTC
ATCAGCAAACTCCGTCGAGTAGCCCTGTCCCTCTTACACGAGGCGCCGGAACGGAAAGGCGAATTCGCCATCAAG
GCGGACGAGGCGCTCGCGCAGCTGGTGGAGTCGTTGAGCAAGTTGGATAGCTGGTCATCATCATCGTCATCGTCG
TCGTCGTCGTCGTCGTCGTCGGATCAGTCGCTCATGATGACGGCCGAGGACGAGCACGTCGAGTTGAGGGCCTGG
GCCGAGTTGAGGGATTTCCAGCTTCGCTTTGTGGCGGATGCTGGCTTTGCGGATTTGCTGGGCGGAGTCCATGGT
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail