Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|653
Gene name
Locationscaffold_1177:920..2027
Strand-
Gene length (bp)1107
Transcript length (bp)1107
Coding sequence length (bp)1104
Protein length (aa) 368

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.4219 0.1381 0.7226 0.2404 0.198 0.0549 0.3293 0.3771 0.4292 0.0262

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup759
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1
Ophiocordyceps australis map64 (Brazil) OphauB2|6147
Ophiocordyceps camponoti-floridani Ophcf2|05796
Ophiocordyceps camponoti-rufipedis Ophun1|5133
Ophiocordyceps kimflemingae Ophio5|653 (this protein)
Ophiocordyceps subramaniannii Hirsu2|245

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|653
MQQLVAGHHIRDSLDTVLPKIKLGSKDFDIYHRQKACGADQASCNKGFDVGQEGWNLDKYKNIHMAEKTYALRPD
RDWYLFVDADTYVFWPTLIKWLEKLDAGKKHYMGSIAYVGNFPFGHGGSGYLLSQAAMRDMFHGRAGVANRWDEY
ITHQCCGDFAFSYALKNETGIAVESAWPTINGEKPFTLPYAENGWCQPIVTMHHMDPEEVSNMWAFEQERAFSHP
MRIRDLYHRFVQDKLVAVRNDWDNLSETANYLNASAFQYSDWELERARKSDLSALELMAHKSFDDCRRVCQSLEK
CVQYHFRNGICSISHTIRHGKPVKPEKEEHKAQWQHRSGWMVKRIHDWVEAHDNCRGVQYPVEDSWLS
Coding >Ophio5|653
ATGCAGCAGTTGGTGGCTGGTCATCACATCCGCGACAGCCTCGACACCGTCCTGCCCAAGATCAAGCTCGGCAGC
AAGGACTTTGACATCTACCATCGCCAGAAAGCATGTGGTGCCGATCAGGCCTCCTGTAACAAGGGCTTCGACGTC
GGCCAGGAGGGCTGGAATCTCGACAAGTACAAGAACATCCACATGGCCGAGAAGACGTACGCCTTGCGGCCCGAC
CGCGACTGGTATCTCTTTGTCGATGCCGACACCTACGTCTTCTGGCCCACGCTCATCAAGTGGCTCGAGAAGCTC
GACGCCGGCAAGAAGCACTACATGGGCAGCATCGCCTACGTCGGCAACTTTCCCTTCGGTCACGGCGGCAGCGGC
TATCTCCTCTCGCAGGCCGCCATGAGGGACATGTTCCACGGCCGCGCCGGCGTCGCCAACCGCTGGGACGAATAC
ATCACCCATCAGTGCTGCGGCGACTTCGCCTTCTCCTACGCCCTCAAGAACGAGACGGGCATCGCCGTGGAGAGC
GCCTGGCCCACCATCAACGGCGAGAAACCCTTCACGTTGCCGTATGCGGAAAACGGCTGGTGCCAACCCATCGTC
ACCATGCACCACATGGACCCCGAGGAGGTGTCCAACATGTGGGCCTTTGAGCAGGAGCGAGCCTTTTCCCATCCG
ATGCGCATCAGGGACCTGTACCATCGTTTCGTCCAGGACAAGCTGGTGGCGGTGCGGAACGACTGGGACAACCTG
AGCGAGACGGCCAATTACCTCAACGCCTCGGCCTTTCAATATTCCGACTGGGAGCTCGAACGGGCCAGGAAGTCG
GACCTCTCGGCCCTGGAGCTCATGGCCCACAAGAGCTTCGACGACTGCCGGAGGGTGTGCCAGAGCCTCGAAAAA
TGCGTCCAGTACCACTTCCGCAACGGCATCTGCTCCATCAGCCACACCATCCGCCATGGAAAGCCAGTCAAACCG
GAGAAGGAGGAGCACAAGGCACAATGGCAGCACCGGAGCGGATGGATGGTCAAGAGGATCCATGACTGGGTCGAG
GCACACGACAATTGCCGTGGCGTCCAATACCCCGTCGAGGACAGTTGGCTGAGC
Transcript >Ophio5|653
ATGCAGCAGTTGGTGGCTGGTCATCACATCCGCGACAGCCTCGACACCGTCCTGCCCAAGATCAAGCTCGGCAGC
AAGGACTTTGACATCTACCATCGCCAGAAAGCATGTGGTGCCGATCAGGCCTCCTGTAACAAGGGCTTCGACGTC
GGCCAGGAGGGCTGGAATCTCGACAAGTACAAGAACATCCACATGGCCGAGAAGACGTACGCCTTGCGGCCCGAC
CGCGACTGGTATCTCTTTGTCGATGCCGACACCTACGTCTTCTGGCCCACGCTCATCAAGTGGCTCGAGAAGCTC
GACGCCGGCAAGAAGCACTACATGGGCAGCATCGCCTACGTCGGCAACTTTCCCTTCGGTCACGGCGGCAGCGGC
TATCTCCTCTCGCAGGCCGCCATGAGGGACATGTTCCACGGCCGCGCCGGCGTCGCCAACCGCTGGGACGAATAC
ATCACCCATCAGTGCTGCGGCGACTTCGCCTTCTCCTACGCCCTCAAGAACGAGACGGGCATCGCCGTGGAGAGC
GCCTGGCCCACCATCAACGGCGAGAAACCCTTCACGTTGCCGTATGCGGAAAACGGCTGGTGCCAACCCATCGTC
ACCATGCACCACATGGACCCCGAGGAGGTGTCCAACATGTGGGCCTTTGAGCAGGAGCGAGCCTTTTCCCATCCG
ATGCGCATCAGGGACCTGTACCATCGTTTCGTCCAGGACAAGCTGGTGGCGGTGCGGAACGACTGGGACAACCTG
AGCGAGACGGCCAATTACCTCAACGCCTCGGCCTTTCAATATTCCGACTGGGAGCTCGAACGGGCCAGGAAGTCG
GACCTCTCGGCCCTGGAGCTCATGGCCCACAAGAGCTTCGACGACTGCCGGAGGGTGTGCCAGAGCCTCGAAAAA
TGCGTCCAGTACCACTTCCGCAACGGCATCTGCTCCATCAGCCACACCATCCGCCATGGAAAGCCAGTCAAACCG
GAGAAGGAGGAGCACAAGGCACAATGGCAGCACCGGAGCGGATGGATGGTCAAGAGGATCCATGACTGGGTCGAG
GCACACGACAATTGCCGTGGCGTCCAATACCCCGTCGAGGACAGTTGGCTGAGCTGA
Gene >Ophio5|653
ATGCAGCAGTTGGTGGCTGGTCATCACATCCGCGACAGCCTCGACACCGTCCTGCCCAAGATCAAGCTCGGCAGC
AAGGACTTTGACATCTACCATCGCCAGAAAGCATGTGGTGCCGATCAGGCCTCCTGTAACAAGGGCTTCGACGTC
GGCCAGGAGGGCTGGAATCTCGACAAGTACAAGAACATCCACATGGCCGAGAAGACGTACGCCTTGCGGCCCGAC
CGCGACTGGTATCTCTTTGTCGATGCCGACACCTACGTCTTCTGGCCCACGCTCATCAAGTGGCTCGAGAAGCTC
GACGCCGGCAAGAAGCACTACATGGGCAGCATCGCCTACGTCGGCAACTTTCCCTTCGGTCACGGCGGCAGCGGC
TATCTCCTCTCGCAGGCCGCCATGAGGGACATGTTCCACGGCCGCGCCGGCGTCGCCAACCGCTGGGACGAATAC
ATCACCCATCAGTGCTGCGGCGACTTCGCCTTCTCCTACGCCCTCAAGAACGAGACGGGCATCGCCGTGGAGAGC
GCCTGGCCCACCATCAACGGCGAGAAACCCTTCACGTTGCCGTATGCGGAAAACGGCTGGTGCCAACCCATCGTC
ACCATGCACCACATGGACCCCGAGGAGGTGTCCAACATGTGGGCCTTTGAGCAGGAGCGAGCCTTTTCCCATCCG
ATGCGCATCAGGGACCTGTACCATCGTTTCGTCCAGGACAAGCTGGTGGCGGTGCGGAACGACTGGGACAACCTG
AGCGAGACGGCCAATTACCTCAACGCCTCGGCCTTTCAATATTCCGACTGGGAGCTCGAACGGGCCAGGAAGTCG
GACCTCTCGGCCCTGGAGCTCATGGCCCACAAGAGCTTCGACGACTGCCGGAGGGTGTGCCAGAGCCTCGAAAAA
TGCGTCCAGTACCACTTCCGCAACGGCATCTGCTCCATCAGCCACACCATCCGCCATGGAAAGCCAGTCAAACCG
GAGAAGGAGGAGCACAAGGCACAATGGCAGCACCGGAGCGGATGGATGGTCAAGAGGATCCATGACTGGGTCGAG
GCACACGACAATTGCCGTGGCGTCCAATACCCCGTCGAGGACAGTTGGCTGAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail