Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6516
Gene name
Locationscaffold_574:4585..6303
Strand+
Gene length (bp)1718
Transcript length (bp)1605
Coding sequence length (bp)1602
Protein length (aa) 534

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02207 zf-UBR Putative zinc finger in N-recognin (UBR box) 1.1E-14 56 129

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09329|MLO2_SCHPO Protein mlo2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mlo2 PE=2 SV=1 30 199 2.0E-36
sp|Q8N806|UBR7_HUMAN Putative E3 ubiquitin-protein ligase UBR7 OS=Homo sapiens GN=UBR7 PE=1 SV=2 54 195 2.0E-16
sp|Q8BU04|UBR7_MOUSE Putative E3 ubiquitin-protein ligase UBR7 OS=Mus musculus GN=Ubr7 PE=1 SV=1 54 195 1.0E-15
sp|Q54DV0|UBR7_DICDI Putative E3 ubiquitin-protein ligase ubr7 OS=Dictyostelium discoideum GN=ubr7 PE=3 SV=2 56 199 2.0E-13
sp|Q09329|MLO2_SCHPO Protein mlo2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mlo2 PE=2 SV=1 381 498 7.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09329|MLO2_SCHPO Protein mlo2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mlo2 PE=2 SV=1 30 199 2.0E-36
sp|Q8N806|UBR7_HUMAN Putative E3 ubiquitin-protein ligase UBR7 OS=Homo sapiens GN=UBR7 PE=1 SV=2 54 195 2.0E-16
sp|Q8BU04|UBR7_MOUSE Putative E3 ubiquitin-protein ligase UBR7 OS=Mus musculus GN=Ubr7 PE=1 SV=1 54 195 1.0E-15
sp|Q54DV0|UBR7_DICDI Putative E3 ubiquitin-protein ligase ubr7 OS=Dictyostelium discoideum GN=ubr7 PE=3 SV=2 56 199 2.0E-13
sp|Q09329|MLO2_SCHPO Protein mlo2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mlo2 PE=2 SV=1 381 498 7.0E-13
sp|Q8N806|UBR7_HUMAN Putative E3 ubiquitin-protein ligase UBR7 OS=Homo sapiens GN=UBR7 PE=1 SV=2 262 500 3.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6516
MSDPPPPAANGHTGLSRSNSFSQQSDDSQTAADFLRDQELLEADAREALPYSIDSCTKILGSLRQNVFACLTCNP
PPPQPNDTWIPAGVCYACSVQCHGEHNLVEIFLKRNFTCDCGTTRIPSTSPCKLRLNDATDTKGGVHSEEPGANQ
YNQNFRNRFCACECDYDPFQQKGTMFQCLGLGTPETGGCGEDWYHPGCLVGLGPKWFEKMDGYGKAKSPKSSATG
SALATIAEDGEQQGGDNVTGEAAVDDDDDPPMPPGFPGEDDFEGFLCYKCVESNPWIKQYAGIGAFLPAVFLDRP
EADWDAVAVCKKRKAEDGPEEEAEAKRVKKETDTTDKAPSLEPAEAPSSAGVVSESAEGVPSETADASSTASCKL
STLPPAPTGRFSLFFSDRFRDTLCHCTPCYRRLNAHPQLLEEEEAYEPPLSADGDSQHGGSTLGSGSLLERGESA
LRNVDRVRAIEGVMAYNHLKEQLKPFFQQFAESGKAVGAEDIKAYFAKLRGDDTAIGDAAAAATGGAQGGEGEGA
DGRREQSGY
Coding >Ophio5|6516
ATGTCCGATCCGCCGCCGCCAGCCGCCAATGGCCACACCGGACTGTCCCGGAGCAACAGCTTCTCCCAGCAGTCA
GACGACTCTCAAACGGCCGCCGACTTTCTTCGTGACCAGGAATTGCTCGAGGCCGACGCTCGCGAAGCTCTCCCC
TACAGCATCGACAGCTGCACAAAAATCCTCGGTTCATTGCGGCAAAATGTCTTCGCTTGCCTGACGTGCAACCCG
CCGCCGCCTCAGCCGAACGATACATGGATCCCGGCCGGAGTCTGCTACGCTTGCTCAGTCCAATGCCATGGCGAG
CACAATCTCGTCGAAATCTTCCTAAAAAGAAACTTCACCTGTGACTGCGGCACCACCCGCATTCCATCGACGAGC
CCCTGCAAGCTTCGCCTCAATGACGCGACCGACACCAAGGGGGGCGTGCATTCGGAGGAGCCCGGCGCCAATCAG
TACAATCAGAATTTCCGCAACCGTTTTTGCGCGTGCGAATGCGACTATGATCCCTTCCAGCAGAAGGGGACAATG
TTCCAATGCCTGGGTTTGGGAACGCCCGAGACGGGCGGTTGCGGCGAGGATTGGTATCACCCGGGCTGCCTTGTC
GGCTTGGGTCCCAAATGGTTTGAGAAAATGGACGGCTATGGCAAGGCCAAGTCGCCCAAGAGTTCTGCCACTGGA
AGTGCTCTGGCCACCATCGCCGAAGATGGCGAGCAGCAGGGAGGAGACAATGTGACCGGCGAGGCCGCCGTCGAT
GATGATGACGACCCACCAATGCCCCCTGGCTTTCCGGGCGAGGACGACTTTGAGGGCTTCCTGTGCTACAAGTGC
GTCGAGTCGAATCCCTGGATCAAGCAGTATGCCGGCATTGGAGCCTTCCTCCCTGCCGTGTTCCTCGACCGCCCA
GAGGCGGACTGGGACGCCGTCGCCGTCTGTAAGAAGCGCAAGGCCGAGGACGGCCCGGAAGAGGAGGCCGAGGCG
AAGCGAGTGAAGAAAGAGACGGATACGACCGACAAGGCGCCCTCTTTGGAGCCTGCCGAGGCCCCTTCGTCGGCG
GGCGTCGTATCCGAATCCGCCGAGGGCGTCCCCTCCGAGACGGCAGACGCCTCCTCAACCGCCAGCTGCAAGCTC
TCGACGCTGCCCCCCGCCCCAACCGGCCGCTTCTCGCTCTTCTTCAGCGACAGATTCCGTGACACGCTCTGCCAT
TGCACCCCCTGCTATCGCCGTCTCAACGCCCACCCCCAACTCCTGGAAGAAGAAGAAGCCTACGAGCCCCCGCTC
TCGGCAGACGGCGACTCCCAACACGGCGGCTCCACTCTCGGAAGCGGCAGCCTCCTAGAGCGCGGCGAGAGCGCA
CTCCGCAACGTGGACCGCGTCCGCGCCATCGAGGGCGTCATGGCCTACAACCACCTCAAGGAGCAGCTCAAGCCC
TTTTTCCAACAGTTTGCCGAGAGCGGCAAGGCCGTCGGCGCAGAGGATATAAAGGCTTACTTTGCCAAGCTCAGG
GGTGACGACACGGCCATCGGTGACGCTGCCGCTGCCGCTACCGGCGGCGCCCAGGGCGGTGAGGGCGAGGGCGCG
GATGGGCGGCGCGAGCAGAGCGGTTAC
Transcript >Ophio5|6516
ATGTCCGATCCGCCGCCGCCAGCCGCCAATGGCCACACCGGACTGTCCCGGAGCAACAGCTTCTCCCAGCAGTCA
GACGACTCTCAAACGGCCGCCGACTTTCTTCGTGACCAGGAATTGCTCGAGGCCGACGCTCGCGAAGCTCTCCCC
TACAGCATCGACAGCTGCACAAAAATCCTCGGTTCATTGCGGCAAAATGTCTTCGCTTGCCTGACGTGCAACCCG
CCGCCGCCTCAGCCGAACGATACATGGATCCCGGCCGGAGTCTGCTACGCTTGCTCAGTCCAATGCCATGGCGAG
CACAATCTCGTCGAAATCTTCCTAAAAAGAAACTTCACCTGTGACTGCGGCACCACCCGCATTCCATCGACGAGC
CCCTGCAAGCTTCGCCTCAATGACGCGACCGACACCAAGGGGGGCGTGCATTCGGAGGAGCCCGGCGCCAATCAG
TACAATCAGAATTTCCGCAACCGTTTTTGCGCGTGCGAATGCGACTATGATCCCTTCCAGCAGAAGGGGACAATG
TTCCAATGCCTGGGTTTGGGAACGCCCGAGACGGGCGGTTGCGGCGAGGATTGGTATCACCCGGGCTGCCTTGTC
GGCTTGGGTCCCAAATGGTTTGAGAAAATGGACGGCTATGGCAAGGCCAAGTCGCCCAAGAGTTCTGCCACTGGA
AGTGCTCTGGCCACCATCGCCGAAGATGGCGAGCAGCAGGGAGGAGACAATGTGACCGGCGAGGCCGCCGTCGAT
GATGATGACGACCCACCAATGCCCCCTGGCTTTCCGGGCGAGGACGACTTTGAGGGCTTCCTGTGCTACAAGTGC
GTCGAGTCGAATCCCTGGATCAAGCAGTATGCCGGCATTGGAGCCTTCCTCCCTGCCGTGTTCCTCGACCGCCCA
GAGGCGGACTGGGACGCCGTCGCCGTCTGTAAGAAGCGCAAGGCCGAGGACGGCCCGGAAGAGGAGGCCGAGGCG
AAGCGAGTGAAGAAAGAGACGGATACGACCGACAAGGCGCCCTCTTTGGAGCCTGCCGAGGCCCCTTCGTCGGCG
GGCGTCGTATCCGAATCCGCCGAGGGCGTCCCCTCCGAGACGGCAGACGCCTCCTCAACCGCCAGCTGCAAGCTC
TCGACGCTGCCCCCCGCCCCAACCGGCCGCTTCTCGCTCTTCTTCAGCGACAGATTCCGTGACACGCTCTGCCAT
TGCACCCCCTGCTATCGCCGTCTCAACGCCCACCCCCAACTCCTGGAAGAAGAAGAAGCCTACGAGCCCCCGCTC
TCGGCAGACGGCGACTCCCAACACGGCGGCTCCACTCTCGGAAGCGGCAGCCTCCTAGAGCGCGGCGAGAGCGCA
CTCCGCAACGTGGACCGCGTCCGCGCCATCGAGGGCGTCATGGCCTACAACCACCTCAAGGAGCAGCTCAAGCCC
TTTTTCCAACAGTTTGCCGAGAGCGGCAAGGCCGTCGGCGCAGAGGATATAAAGGCTTACTTTGCCAAGCTCAGG
GGTGACGACACGGCCATCGGTGACGCTGCCGCTGCCGCTACCGGCGGCGCCCAGGGCGGTGAGGGCGAGGGCGCG
GATGGGCGGCGCGAGCAGAGCGGTTACTGA
Gene >Ophio5|6516
ATGTCCGATCCGCCGCCGCCAGCCGCCAATGGCCACACCGGACTGTCCCGGAGCAACAGCTTCTCCCAGCAGTCA
GACGACTCTCAAACGGCCGCCGAGTGAGTTTCATGCCCTGAGAAGTCATGGAAACGCACTCATCGACTAACATAT
GGCGCTGCAGCTTTCTTCGTGACCAGGAATTGCTCGAGGCCGACGCTCGCGAAGCTCTCCCCTACGTACGCTTGC
TTGCCCCCCTCCTCGAGAAAAGAGGCTAACAAACTTTCCAGAGCATCGACAGCTGCACAAAAATCCTCGGTTCAT
TGCGGCAAAATGTCTTCGCTTGCCTGACGTGCAACCCGCCGCCGCCTCAGCCGAACGATACATGGATCCCGGCCG
GAGTCTGCTACGCTTGCTCAGTCCAATGCCATGGCGAGCACAATCTCGTCGAAATCTTCCTAAAAAGAAACTTCA
CCTGTGACTGCGGCACCACCCGCATTCCATCGACGAGCCCCTGCAAGCTTCGCCTCAATGACGCGACCGACACCA
AGGGGGGCGTGCATTCGGAGGAGCCCGGCGCCAATCAGTACAATCAGAATTTCCGCAACCGTTTTTGCGCGTGCG
AATGCGACTATGATCCCTTCCAGCAGAAGGGGACAATGTTCCAATGCCTGGGTTTGGGAACGCCCGAGACGGGCG
GTTGCGGCGAGGATTGGTATCACCCGGGCTGCCTTGTCGGCTTGGGTCCCAAATGGTTTGAGAAAATGGACGGCT
ATGGCAAGGCCAAGTCGCCCAAGAGTTCTGCCACTGGAAGTGCTCTGGCCACCATCGCCGAAGATGGCGAGCAGC
AGGGAGGAGACAATGTGACCGGCGAGGCCGCCGTCGATGATGATGACGACCCACCAATGCCCCCTGGCTTTCCGG
GCGAGGACGACTTTGAGGGCTTCCTGTGCTACAAGTGCGTCGAGTCGAATCCCTGGATCAAGCAGTATGCCGGCA
TTGGAGCCTTCCTCCCTGCCGTGTTCCTCGACCGCCCAGAGGCGGACTGGGACGCCGTCGCCGTCTGTAAGAAGC
GCAAGGCCGAGGACGGCCCGGAAGAGGAGGCCGAGGCGAAGCGAGTGAAGAAAGAGACGGATACGACCGACAAGG
CGCCCTCTTTGGAGCCTGCCGAGGCCCCTTCGTCGGCGGGCGTCGTATCCGAATCCGCCGAGGGCGTCCCCTCCG
AGACGGCAGACGCCTCCTCAACCGCCAGCTGCAAGCTCTCGACGCTGCCCCCCGCCCCAACCGGCCGCTTCTCGC
TCTTCTTCAGCGACAGATTCCGTGACACGCTCTGCCATTGCACCCCCTGCTATCGCCGTCTCAACGCCCACCCCC
AACTCCTGGAAGAAGAAGAAGCCTACGAGCCCCCGCTCTCGGCAGACGGCGACTCCCAACACGGCGGCTCCACTC
TCGGAAGCGGCAGCCTCCTAGAGCGCGGCGAGAGCGCACTCCGCAACGTGGACCGCGTCCGCGCCATCGAGGGCG
TCATGGCCTACAACCACCTCAAGGAGCAGCTCAAGCCCTTTTTCCAACAGTTTGCCGAGAGCGGCAAGGCCGTCG
GCGCAGAGGATATAAAGGCTTACTTTGCCAAGCTCAGGGGTGACGACACGGCCATCGGTGACGCTGCCGCTGCCG
CTACCGGCGGCGCCCAGGGCGGTGAGGGCGAGGGCGCGGATGGGCGGCGCGAGCAGAGCGGTTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail