Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6514
Gene name
Locationscaffold_573:3465..6536
Strand-
Gene length (bp)3071
Transcript length (bp)2418
Coding sequence length (bp)2415
Protein length (aa) 805

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06733 DEAD_2 DEAD_2 1.3E-54 71 255
PF06777 HBB Helical and beta-bridge domain 1.9E-44 269 412
PF13307 Helicase_C_2 Helicase C-terminal domain 5.7E-43 524 696

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P06839|RAD3_YEAST DNA repair helicase RAD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD3 PE=1 SV=1 1 745 0.0E+00
sp|A6QLJ0|ERCC2_BOVIN TFIIH basal transcription factor complex helicase XPD subunit OS=Bos taurus GN=ERCC2 PE=2 SV=1 1 729 0.0E+00
sp|Q60452|ERCC2_CRIGR TFIIH basal transcription factor complex helicase XPD subunit OS=Cricetulus griseus GN=ERCC2 PE=1 SV=1 1 729 0.0E+00
sp|O08811|ERCC2_MOUSE TFIIH basal transcription factor complex helicase XPD subunit OS=Mus musculus GN=Ercc2 PE=1 SV=2 1 729 0.0E+00
sp|P18074|ERCC2_HUMAN TFIIH basal transcription factor complex helicase XPD subunit OS=Homo sapiens GN=ERCC2 PE=1 SV=1 1 729 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P06839|RAD3_YEAST DNA repair helicase RAD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD3 PE=1 SV=1 1 745 0.0E+00
sp|A6QLJ0|ERCC2_BOVIN TFIIH basal transcription factor complex helicase XPD subunit OS=Bos taurus GN=ERCC2 PE=2 SV=1 1 729 0.0E+00
sp|Q60452|ERCC2_CRIGR TFIIH basal transcription factor complex helicase XPD subunit OS=Cricetulus griseus GN=ERCC2 PE=1 SV=1 1 729 0.0E+00
sp|O08811|ERCC2_MOUSE TFIIH basal transcription factor complex helicase XPD subunit OS=Mus musculus GN=Ercc2 PE=1 SV=2 1 729 0.0E+00
sp|P18074|ERCC2_HUMAN TFIIH basal transcription factor complex helicase XPD subunit OS=Homo sapiens GN=ERCC2 PE=1 SV=1 1 729 0.0E+00
sp|Q8W4M7|ERCC2_ARATH DNA repair helicase UVH6 OS=Arabidopsis thaliana GN=UVH6 PE=1 SV=1 1 735 0.0E+00
sp|Q55G81|ERCC2_DICDI TFIIH basal transcription factor complex helicase repD subunit OS=Dictyostelium discoideum GN=repD PE=2 SV=1 1 752 0.0E+00
sp|P26659|RAD15_SCHPO DNA repair helicase rad15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad15 PE=1 SV=2 1 747 0.0E+00
sp|B3MSG8|RTEL1_DROAN Regulator of telomere elongation helicase 1 homolog OS=Drosophila ananassae GN=GF20802 PE=3 SV=1 5 724 1.0E-65
sp|B4PZB4|RTEL1_DROYA Regulator of telomere elongation helicase 1 homolog OS=Drosophila yakuba GN=GE16425 PE=3 SV=1 5 730 3.0E-65
sp|B3NSW1|RTEL1_DROER Regulator of telomere elongation helicase 1 homolog OS=Drosophila erecta GN=GG18780 PE=3 SV=1 5 700 2.0E-64
sp|P0C928|RTEL1_DANRE Regulator of telomere elongation helicase 1 OS=Danio rerio GN=rtel1 PE=3 SV=1 5 694 3.0E-58
sp|Q5RJZ1|RTEL1_RAT Regulator of telomere elongation helicase 1 OS=Rattus norvegicus GN=Rtel1 PE=2 SV=2 5 694 2.0E-55
sp|Q2U587|CHL1_ASPOR ATP-dependent DNA helicase chl1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=chl1 PE=3 SV=1 13 718 3.0E-47
sp|Q9BX63|FANCJ_HUMAN Fanconi anemia group J protein OS=Homo sapiens GN=BRIP1 PE=1 SV=1 108 698 5.0E-44
sp|Q7QEI1|RTEL1_ANOGA Regulator of telomere elongation helicase 1 homolog OS=Anopheles gambiae GN=AGAP000634 PE=3 SV=5 431 729 7.0E-40
sp|Q5SXJ3|FANCJ_MOUSE Fanconi anemia group J protein homolog OS=Mus musculus GN=Brip1 PE=2 SV=1 65 698 9.0E-40
sp|Q3YK19|FANCJ_CHICK Fanconi anemia group J protein homolog OS=Gallus gallus GN=BRIP1 PE=2 SV=1 68 696 1.0E-38
sp|A2QY22|CHL1_ASPNC ATP-dependent DNA helicase chl1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=chl1 PE=3 SV=1 432 720 4.0E-38
sp|B0W9F4|RTEL1_CULQU Regulator of telomere elongation helicase 1 homolog OS=Culex quinquefasciatus GN=CPIJ003765 PE=3 SV=1 431 701 3.0E-37
sp|Q29FS3|RTEL1_DROPS Regulator of telomere elongation helicase 1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA17940 PE=3 SV=2 410 724 4.0E-37
sp|B4GU19|RTEL1_DROPE Regulator of telomere elongation helicase 1 homolog OS=Drosophila persimilis GN=GL14463 PE=3 SV=1 410 724 4.0E-37
sp|Q1E5T3|CHL1_COCIM ATP-dependent DNA helicase CHL1 OS=Coccidioides immitis (strain RS) GN=CHL1 PE=3 SV=1 388 703 1.0E-36
sp|Q16X92|RTEL1_AEDAE Regulator of telomere elongation helicase 1 homolog OS=Aedes aegypti GN=AAEL008960 PE=3 SV=1 431 698 1.0E-36
sp|B4M891|RTEL1_DROVI Regulator of telomere elongation helicase 1 homolog OS=Drosophila virilis GN=GJ16649 PE=3 SV=1 431 724 2.0E-36
sp|B4I0K4|RTEL1_DROSE Regulator of telomere elongation helicase 1 homolog OS=Drosophila sechellia GN=GM12432 PE=3 SV=1 431 700 2.0E-35
sp|Q9W484|RTEL1_DROME Regulator of telomere elongation helicase 1 homolog OS=Drosophila melanogaster GN=CG4078 PE=1 SV=1 431 730 2.0E-35
sp|B4L1Z2|RTEL1_DROMO Regulator of telomere elongation helicase 1 homolog OS=Drosophila mojavensis GN=GI15901 PE=3 SV=1 431 724 3.0E-35
sp|B4JNS2|RTEL1_DROGR Regulator of telomere elongation helicase 1 homolog OS=Drosophila grimshawi GN=GH24089 PE=3 SV=1 431 724 5.0E-35
sp|A1D8E4|CHL1_NEOFI ATP-dependent DNA helicase chl1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=chl1 PE=3 SV=1 432 699 1.0E-34
sp|B4NDG5|RTEL1_DROWI Regulator of telomere elongation helicase 1 homolog OS=Drosophila willistoni GN=GK24923 PE=3 SV=1 431 730 2.0E-34
sp|Q4WWE9|CHL1_ASPFU ATP-dependent DNA helicase chl1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chl1 PE=3 SV=1 432 699 3.0E-34
sp|Q6BZD9|CHL1_DEBHA ATP-dependent DNA helicase CHL1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CHL1 PE=3 SV=2 68 699 2.0E-32
sp|A1CJ34|CHL1_ASPCL ATP-dependent DNA helicase chl1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=chl1 PE=3 SV=1 434 718 3.0E-32
sp|A7TTL0|CHL1_VANPO ATP-dependent DNA helicase CHL1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CHL1 PE=3 SV=1 68 694 4.0E-32
sp|O14147|CHL1_SCHPO ATP-dependent DNA helicase chl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chl1 PE=3 SV=1 420 698 1.0E-31
sp|A7ERG1|CHL1_SCLS1 ATP-dependent DNA helicase CHL1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=CHL1 PE=3 SV=1 101 722 2.0E-31
sp|A8WS58|RTEL1_CAEBR Regulator of telomere elongation helicase 1 homolog OS=Caenorhabditis briggsae GN=rtel-1 PE=3 SV=1 431 717 3.0E-31
sp|Q6CIF0|CHL1_KLULA ATP-dependent DNA helicase CHL1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CHL1 PE=3 SV=1 68 694 5.0E-30
sp|Q6H1L8|RTEL1_MUSSP Regulator of telomere elongation helicase 1 OS=Mus spretus GN=Rtel1 PE=2 SV=1 431 694 8.0E-30
sp|Q0VGM9|RTEL1_MOUSE Regulator of telomere elongation helicase 1 OS=Mus musculus GN=Rtel1 PE=1 SV=2 431 694 3.0E-29
sp|Q6AXC6|DDX11_MOUSE Probable ATP-dependent DNA helicase DDX11 OS=Mus musculus GN=Ddx11 PE=1 SV=1 395 724 5.0E-29
sp|A4K436|RTEL1_BOVIN Regulator of telomere elongation helicase 1 OS=Bos taurus GN=RTEL1 PE=2 SV=1 420 694 8.0E-29
sp|Q92771|DDX12_HUMAN Putative ATP-dependent RNA helicase DDX12 OS=Homo sapiens GN=DDX12P PE=5 SV=3 395 694 1.0E-28
sp|Q5AD67|CHL1_CANAL ATP-dependent DNA helicase CHL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHL1 PE=3 SV=1 68 696 5.0E-28
sp|A3LN13|CHL1_PICST ATP-dependent DNA helicase CHL1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=CHL1 PE=3 SV=2 434 723 1.0E-27
sp|Q5RE34|RTEL1_PONAB Regulator of telomere elongation helicase 1 OS=Pongo abelii GN=RTEL1 PE=2 SV=1 431 694 1.0E-27
sp|Q9NZ71|RTEL1_HUMAN Regulator of telomere elongation helicase 1 OS=Homo sapiens GN=RTEL1 PE=1 SV=2 452 694 5.0E-27
sp|Q0VGM9|RTEL1_MOUSE Regulator of telomere elongation helicase 1 OS=Mus musculus GN=Rtel1 PE=1 SV=2 5 284 9.0E-27
sp|A5DNW6|CHL1_PICGU ATP-dependent DNA helicase CHL1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=CHL1 PE=3 SV=2 434 698 1.0E-26
sp|Q750G3|CHL1_ASHGO ATP-dependent DNA helicase CHL1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CHL1 PE=3 SV=1 68 701 2.0E-26
sp|A8MPP1|D11L8_HUMAN Putative ATP-dependent RNA helicase DDX11-like protein 8 OS=Homo sapiens GN=DDX11L8 PE=1 SV=1 395 717 3.0E-26
sp|Q6H1L8|RTEL1_MUSSP Regulator of telomere elongation helicase 1 OS=Mus spretus GN=Rtel1 PE=2 SV=1 5 284 3.0E-26
sp|Q93575|RTEL1_CAEEL Regulator of telomere elongation helicase 1 homolog OS=Caenorhabditis elegans GN=rtel-1 PE=3 SV=3 434 704 8.0E-26
sp|Q9W484|RTEL1_DROME Regulator of telomere elongation helicase 1 homolog OS=Drosophila melanogaster GN=CG4078 PE=1 SV=1 5 258 9.0E-25
sp|Q96FC9|DDX11_HUMAN Probable ATP-dependent DNA helicase DDX11 OS=Homo sapiens GN=DDX11 PE=1 SV=1 376 646 1.0E-24
sp|A4K436|RTEL1_BOVIN Regulator of telomere elongation helicase 1 OS=Bos taurus GN=RTEL1 PE=2 SV=1 2 251 2.0E-23
sp|Q9NZ71|RTEL1_HUMAN Regulator of telomere elongation helicase 1 OS=Homo sapiens GN=RTEL1 PE=1 SV=2 2 255 2.0E-23
sp|Q21489|CHL1_CAEEL ATP-dependent DNA helicase chl-1 OS=Caenorhabditis elegans GN=chl-1 PE=3 SV=2 432 694 2.0E-23
sp|Q6CAX3|CHL1_YARLI ATP-dependent DNA helicase CHL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CHL1 PE=3 SV=1 434 698 7.0E-23
sp|B4M891|RTEL1_DROVI Regulator of telomere elongation helicase 1 homolog OS=Drosophila virilis GN=GJ16649 PE=3 SV=1 5 250 9.0E-23
sp|B4GU19|RTEL1_DROPE Regulator of telomere elongation helicase 1 homolog OS=Drosophila persimilis GN=GL14463 PE=3 SV=1 5 250 1.0E-22
sp|Q29FS3|RTEL1_DROPS Regulator of telomere elongation helicase 1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA17940 PE=3 SV=2 5 250 1.0E-22
sp|B4JNS2|RTEL1_DROGR Regulator of telomere elongation helicase 1 homolog OS=Drosophila grimshawi GN=GH24089 PE=3 SV=1 5 250 2.0E-22
sp|B4NDG5|RTEL1_DROWI Regulator of telomere elongation helicase 1 homolog OS=Drosophila willistoni GN=GK24923 PE=3 SV=1 5 250 2.0E-22
sp|Q5RE34|RTEL1_PONAB Regulator of telomere elongation helicase 1 OS=Pongo abelii GN=RTEL1 PE=2 SV=1 2 278 3.0E-22
sp|B4L1Z2|RTEL1_DROMO Regulator of telomere elongation helicase 1 homolog OS=Drosophila mojavensis GN=GI15901 PE=3 SV=1 5 250 2.0E-21
sp|A6ZWN8|CHL1_YEAS7 ATP-dependent DNA helicase CHL1 OS=Saccharomyces cerevisiae (strain YJM789) GN=CHL1 PE=3 SV=1 434 718 2.0E-21
sp|P22516|CHL1_YEAST ATP-dependent DNA helicase CHL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHL1 PE=1 SV=1 434 718 2.0E-21
sp|Q7QEI1|RTEL1_ANOGA Regulator of telomere elongation helicase 1 homolog OS=Anopheles gambiae GN=AGAP000634 PE=3 SV=5 2 244 7.0E-21
sp|A5DUW8|CHL1_LODEL ATP-dependent DNA helicase CHL1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=CHL1 PE=3 SV=1 432 694 3.0E-20
sp|Q6FKT4|CHL1_CANGA ATP-dependent DNA helicase CHL1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CHL1 PE=3 SV=1 430 694 4.0E-20
sp|Q16X92|RTEL1_AEDAE Regulator of telomere elongation helicase 1 homolog OS=Aedes aegypti GN=AAEL008960 PE=3 SV=1 2 250 1.0E-19
sp|A8WS58|RTEL1_CAEBR Regulator of telomere elongation helicase 1 homolog OS=Caenorhabditis briggsae GN=rtel-1 PE=3 SV=1 10 255 4.0E-19
sp|Q93575|RTEL1_CAEEL Regulator of telomere elongation helicase 1 homolog OS=Caenorhabditis elegans GN=rtel-1 PE=3 SV=3 8 255 5.0E-19
sp|B0W9F4|RTEL1_CULQU Regulator of telomere elongation helicase 1 homolog OS=Culex quinquefasciatus GN=CPIJ003765 PE=3 SV=1 5 250 1.0E-18
sp|Q9HM14|XPD_THEAC ATP-dependent DNA helicase Ta0057 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0057 PE=1 SV=1 38 691 5.0E-18
sp|A7UXD4|CHL1_NEUCR ATP-dependent DNA helicase chl1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chl1 PE=3 SV=2 396 643 6.0E-18
sp|B4I0K4|RTEL1_DROSE Regulator of telomere elongation helicase 1 homolog OS=Drosophila sechellia GN=GM12432 PE=3 SV=1 5 250 7.0E-16
sp|A1CJ34|CHL1_ASPCL ATP-dependent DNA helicase chl1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=chl1 PE=3 SV=1 68 258 3.0E-12
sp|Q6CAX3|CHL1_YARLI ATP-dependent DNA helicase CHL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CHL1 PE=3 SV=1 52 268 8.0E-11
sp|A1D8E4|CHL1_NEOFI ATP-dependent DNA helicase chl1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=chl1 PE=3 SV=1 68 252 1.0E-10
sp|Q1E5T3|CHL1_COCIM ATP-dependent DNA helicase CHL1 OS=Coccidioides immitis (strain RS) GN=CHL1 PE=3 SV=1 68 256 9.0E-10
sp|A7UXD4|CHL1_NEUCR ATP-dependent DNA helicase chl1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chl1 PE=3 SV=2 65 258 2.0E-09
sp|Q96FC9|DDX11_HUMAN Probable ATP-dependent DNA helicase DDX11 OS=Homo sapiens GN=DDX11 PE=1 SV=1 68 267 2.0E-09
sp|Q92771|DDX12_HUMAN Putative ATP-dependent RNA helicase DDX12 OS=Homo sapiens GN=DDX12P PE=5 SV=3 68 267 3.0E-09
sp|O14147|CHL1_SCHPO ATP-dependent DNA helicase chl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chl1 PE=3 SV=1 46 242 4.0E-09
sp|Q4WWE9|CHL1_ASPFU ATP-dependent DNA helicase chl1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chl1 PE=3 SV=1 68 252 5.0E-09
sp|A8MPP1|D11L8_HUMAN Putative ATP-dependent RNA helicase DDX11-like protein 8 OS=Homo sapiens GN=DDX11L8 PE=1 SV=1 68 267 6.0E-09
sp|Q21489|CHL1_CAEEL ATP-dependent DNA helicase chl-1 OS=Caenorhabditis elegans GN=chl-1 PE=3 SV=2 68 260 8.0E-09
sp|P22516|CHL1_YEAST ATP-dependent DNA helicase CHL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHL1 PE=1 SV=1 68 261 2.0E-08
sp|Q6FKT4|CHL1_CANGA ATP-dependent DNA helicase CHL1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CHL1 PE=3 SV=1 68 258 3.0E-08
sp|Q6AXC6|DDX11_MOUSE Probable ATP-dependent DNA helicase DDX11 OS=Mus musculus GN=Ddx11 PE=1 SV=1 68 267 3.0E-08
sp|A6ZWN8|CHL1_YEAS7 ATP-dependent DNA helicase CHL1 OS=Saccharomyces cerevisiae (strain YJM789) GN=CHL1 PE=3 SV=1 68 261 6.0E-08
sp|Q9BX63|FANCJ_HUMAN Fanconi anemia group J protein OS=Homo sapiens GN=BRIP1 PE=1 SV=1 2 63 3.0E-07
sp|A5DUW8|CHL1_LODEL ATP-dependent DNA helicase CHL1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=CHL1 PE=3 SV=1 68 261 9.0E-07
sp|A5DNW6|CHL1_PICGU ATP-dependent DNA helicase CHL1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=CHL1 PE=3 SV=2 69 255 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003678 DNA helicase activity Yes
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides Yes
GO:0004386 helicase activity Yes
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:0006139 nucleobase-containing compound metabolic process Yes
GO:0003677 DNA binding Yes
GO:0071704 organic substance metabolic process No
GO:0140097 catalytic activity, acting on DNA No
GO:0032555 purine ribonucleotide binding No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0043167 ion binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0046483 heterocycle metabolic process No
GO:0044238 primary metabolic process No
GO:0140657 ATP-dependent activity No
GO:0043168 anion binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0097159 organic cyclic compound binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:1901265 nucleoside phosphate binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0006807 nitrogen compound metabolic process No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097367 carbohydrate derivative binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0000166 nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0016787 hydrolase activity No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6514
MKFDIDGLPILFPYPKIYPEQYAYMCDLKKTLEAGGHCVLEMPSGTGKTVSLLSLIVAYQQNMPERRKLIYCSRT
MSEIEKALVELKSLMKYRAEQLGYEEDFRGLGLTSRKNLCLHPSVKREKSGSIVDARCRSLTAGFVREKKEKGEN
VQVCIYHDNLDLLEPHNLIPNGVWTFDGILRYGEEHKQCPYFTARRMMQYCNVVIFSYHYMLDPKIAERVSRDFS
KDCIVVFDEAHNIDNVCIESLSTDITEDSLRKASRGAQNLERKIAEMRDTDQEQLQNEYQKLVQGLRDADEARQE
DAFASNPALPEDLLKEAVPGNIRRAEHFVAFLKRFIEYLKTRMRVRQVISETPPSFLGHLKEHTFIERKPLRFCA
ERLTSLARTLELTNIEDYHPLQEVATFATLVATYEKGFLLILEPYESDTAEVPNPIFHFTCLDAAIAIRPVFERF
YSVIITSGTISPLEMYPKMLDFSTVIQESYSMTLARRSFLPMIVTRGSDQASVSTSFQVRNEPSVVRNYGTLLTE
FAKITPDGVVVFFPSYLYMESIISMWQGMGILDEVWKYKLILVETPDAQETSLALETYRTACCNGRGAILLCVAR
GKVSEGIDFDHQYGRTVLCIGVPFQYTESRILKARLEFLRETYRIRENDFLSFDAMRHAAQCLGRVLRGKDDYGI
MVLADRRFQKKRTQLPKWINQGLLDADVNLSTDMAVSSARKFLKTMAQPFRAKDQEGISTWGLDDLRRHREKMDM
DKRLEPEDPSGGSMGRDISTVDGLEIRGSLLGLNTQQILFFTANYRATQEVIPLQ
Coding >Ophio5|6514
ATGAAGTTCGACATCGATGGCTTGCCCATCCTATTTCCGTACCCGAAAATATATCCGGAACAATACGCTTACATG
TGCGATCTCAAAAAGACTCTCGAAGCAGGCGGTCATTGCGTTCTCGAAATGCCTTCAGGAACCGGCAAAACGGTG
TCCCTACTCTCCTTGATCGTCGCATATCAACAAAATATGCCGGAACGTCGAAAGCTCATATACTGCTCACGAACC
ATGTCCGAGATCGAAAAGGCGCTGGTCGAGCTGAAGTCGCTGATGAAATATCGGGCAGAACAACTTGGGTACGAA
GAGGATTTTCGGGGTCTCGGACTGACTAGTCGAAAGAATCTCTGCCTGCATCCATCAGTCAAGCGGGAGAAGAGT
GGATCAATTGTCGACGCTCGCTGCAGGAGCTTAACGGCCGGTTTTGTAAGAGAGAAGAAGGAAAAGGGGGAGAAT
GTTCAGGTCTGCATCTATCACGATAATCTTGATCTCCTGGAACCACACAACTTGATACCCAATGGAGTTTGGACC
TTTGACGGGATCCTTCGATACGGGGAGGAACACAAACAATGCCCCTATTTCACGGCACGAAGGATGATGCAATAC
TGCAACGTTGTCATCTTCTCGTACCACTATATGCTGGATCCCAAGATTGCCGAGCGAGTTTCGCGAGACTTTTCC
AAGGACTGCATTGTGGTCTTTGACGAAGCACACAACATCGACAACGTGTGCATTGAATCCCTTAGCACGGACATC
ACTGAAGATTCTCTGCGGAAAGCATCACGCGGAGCGCAAAACCTTGAGAGGAAGATTGCTGAGATGCGGGACACA
GACCAGGAGCAATTGCAGAATGAATACCAAAAGCTCGTTCAAGGCCTTAGGGATGCTGATGAAGCCCGACAGGAG
GACGCGTTCGCGTCTAATCCTGCTCTCCCCGAAGATCTTCTCAAAGAAGCCGTGCCTGGAAACATAAGGCGAGCT
GAACATTTTGTCGCCTTCTTGAAGCGATTTATAGAATATCTCAAGACCCGGATGAGAGTCCGCCAGGTCATCTCC
GAAACGCCCCCTTCCTTCTTGGGTCATCTCAAGGAACACACATTCATCGAAAGGAAGCCCTTGAGGTTCTGTGCG
GAGCGCCTAACGTCACTCGCGCGGACCCTGGAGTTGACAAACATAGAAGACTACCATCCACTACAGGAGGTGGCT
ACGTTTGCGACACTGGTGGCAACCTATGAGAAGGGCTTCTTGCTGATTTTGGAACCGTACGAATCGGATACTGCT
GAGGTTCCCAATCCCATATTCCATTTTACCTGCCTAGATGCGGCCATTGCAATCCGGCCGGTGTTCGAAAGATTC
TACTCAGTCATCATCACGTCGGGTACTATCTCGCCCCTCGAGATGTATCCCAAGATGCTAGACTTTTCGACCGTC
ATCCAAGAGTCTTACAGCATGACTCTGGCGCGAAGGTCGTTTTTACCCATGATAGTCACTCGCGGCAGTGACCAG
GCCTCTGTTTCGACCAGCTTCCAGGTCAGAAACGAGCCAAGCGTGGTGCGTAACTACGGCACACTTTTGACGGAA
TTTGCCAAAATCACACCCGACGGCGTGGTGGTATTTTTCCCGTCCTACCTCTACATGGAATCCATCATTAGCATG
TGGCAGGGAATGGGCATCCTGGATGAGGTCTGGAAGTACAAGTTGATCCTAGTGGAAACGCCCGACGCGCAGGAG
ACATCGCTGGCTCTTGAGACGTACCGAACCGCGTGCTGCAACGGAAGGGGTGCAATTCTCCTATGTGTGGCCCGG
GGAAAGGTTTCGGAGGGTATCGATTTTGATCACCAGTACGGACGCACGGTGCTTTGCATTGGAGTTCCTTTCCAG
TACACCGAGTCACGGATACTCAAGGCGAGGCTCGAGTTTCTACGGGAGACTTACCGCATCAGAGAAAATGACTTT
CTATCCTTCGATGCCATGCGCCATGCCGCGCAGTGTCTCGGACGAGTGCTGCGAGGCAAGGATGATTATGGAATC
ATGGTGCTTGCCGACCGCCGCTTTCAGAAGAAGAGGACGCAGTTGCCGAAGTGGATCAACCAGGGACTGCTAGAC
GCCGATGTCAACCTGAGCACCGATATGGCAGTCTCCAGCGCCAGGAAATTCCTCAAGACAATGGCTCAGCCGTTT
CGTGCCAAGGACCAAGAAGGCATTAGTACATGGGGACTCGATGACCTGAGGAGACACAGGGAGAAGATGGACATG
GATAAGCGTCTTGAGCCGGAAGATCCTAGCGGAGGTTCAATGGGCCGTGATATCTCTACCGTCGACGGTTTGGAG
ATTCGGGGGTCCCTTTTGGGACTAAACACCCAACAAATACTCTTCTTTACCGCTAACTACAGGGCAACCCAAGAG
GTCATACCCCTTCAA
Transcript >Ophio5|6514
ATGAAGTTCGACATCGATGGCTTGCCCATCCTATTTCCGTACCCGAAAATATATCCGGAACAATACGCTTACATG
TGCGATCTCAAAAAGACTCTCGAAGCAGGCGGTCATTGCGTTCTCGAAATGCCTTCAGGAACCGGCAAAACGGTG
TCCCTACTCTCCTTGATCGTCGCATATCAACAAAATATGCCGGAACGTCGAAAGCTCATATACTGCTCACGAACC
ATGTCCGAGATCGAAAAGGCGCTGGTCGAGCTGAAGTCGCTGATGAAATATCGGGCAGAACAACTTGGGTACGAA
GAGGATTTTCGGGGTCTCGGACTGACTAGTCGAAAGAATCTCTGCCTGCATCCATCAGTCAAGCGGGAGAAGAGT
GGATCAATTGTCGACGCTCGCTGCAGGAGCTTAACGGCCGGTTTTGTAAGAGAGAAGAAGGAAAAGGGGGAGAAT
GTTCAGGTCTGCATCTATCACGATAATCTTGATCTCCTGGAACCACACAACTTGATACCCAATGGAGTTTGGACC
TTTGACGGGATCCTTCGATACGGGGAGGAACACAAACAATGCCCCTATTTCACGGCACGAAGGATGATGCAATAC
TGCAACGTTGTCATCTTCTCGTACCACTATATGCTGGATCCCAAGATTGCCGAGCGAGTTTCGCGAGACTTTTCC
AAGGACTGCATTGTGGTCTTTGACGAAGCACACAACATCGACAACGTGTGCATTGAATCCCTTAGCACGGACATC
ACTGAAGATTCTCTGCGGAAAGCATCACGCGGAGCGCAAAACCTTGAGAGGAAGATTGCTGAGATGCGGGACACA
GACCAGGAGCAATTGCAGAATGAATACCAAAAGCTCGTTCAAGGCCTTAGGGATGCTGATGAAGCCCGACAGGAG
GACGCGTTCGCGTCTAATCCTGCTCTCCCCGAAGATCTTCTCAAAGAAGCCGTGCCTGGAAACATAAGGCGAGCT
GAACATTTTGTCGCCTTCTTGAAGCGATTTATAGAATATCTCAAGACCCGGATGAGAGTCCGCCAGGTCATCTCC
GAAACGCCCCCTTCCTTCTTGGGTCATCTCAAGGAACACACATTCATCGAAAGGAAGCCCTTGAGGTTCTGTGCG
GAGCGCCTAACGTCACTCGCGCGGACCCTGGAGTTGACAAACATAGAAGACTACCATCCACTACAGGAGGTGGCT
ACGTTTGCGACACTGGTGGCAACCTATGAGAAGGGCTTCTTGCTGATTTTGGAACCGTACGAATCGGATACTGCT
GAGGTTCCCAATCCCATATTCCATTTTACCTGCCTAGATGCGGCCATTGCAATCCGGCCGGTGTTCGAAAGATTC
TACTCAGTCATCATCACGTCGGGTACTATCTCGCCCCTCGAGATGTATCCCAAGATGCTAGACTTTTCGACCGTC
ATCCAAGAGTCTTACAGCATGACTCTGGCGCGAAGGTCGTTTTTACCCATGATAGTCACTCGCGGCAGTGACCAG
GCCTCTGTTTCGACCAGCTTCCAGGTCAGAAACGAGCCAAGCGTGGTGCGTAACTACGGCACACTTTTGACGGAA
TTTGCCAAAATCACACCCGACGGCGTGGTGGTATTTTTCCCGTCCTACCTCTACATGGAATCCATCATTAGCATG
TGGCAGGGAATGGGCATCCTGGATGAGGTCTGGAAGTACAAGTTGATCCTAGTGGAAACGCCCGACGCGCAGGAG
ACATCGCTGGCTCTTGAGACGTACCGAACCGCGTGCTGCAACGGAAGGGGTGCAATTCTCCTATGTGTGGCCCGG
GGAAAGGTTTCGGAGGGTATCGATTTTGATCACCAGTACGGACGCACGGTGCTTTGCATTGGAGTTCCTTTCCAG
TACACCGAGTCACGGATACTCAAGGCGAGGCTCGAGTTTCTACGGGAGACTTACCGCATCAGAGAAAATGACTTT
CTATCCTTCGATGCCATGCGCCATGCCGCGCAGTGTCTCGGACGAGTGCTGCGAGGCAAGGATGATTATGGAATC
ATGGTGCTTGCCGACCGCCGCTTTCAGAAGAAGAGGACGCAGTTGCCGAAGTGGATCAACCAGGGACTGCTAGAC
GCCGATGTCAACCTGAGCACCGATATGGCAGTCTCCAGCGCCAGGAAATTCCTCAAGACAATGGCTCAGCCGTTT
CGTGCCAAGGACCAAGAAGGCATTAGTACATGGGGACTCGATGACCTGAGGAGACACAGGGAGAAGATGGACATG
GATAAGCGTCTTGAGCCGGAAGATCCTAGCGGAGGTTCAATGGGCCGTGATATCTCTACCGTCGACGGTTTGGAG
ATTCGGGGGTCCCTTTTGGGACTAAACACCCAACAAATACTCTTCTTTACCGCTAACTACAGGGCAACCCAAGAG
GTCATACCCCTTCAATAG
Gene >Ophio5|6514
ATGAAGTTCGACATCGAGTATGAAGCCGTAATCTGTCTCGTCAGATCCTCATTCCCGCTAATGGTCATGCAGTGG
CTTGCCCATCCTATTTCCGTACCCGAAAATATATCCGGGTATACCCTGGCCTTCCCTGCCGGTTTCTCTATCGCT
GAACTGACTCGCCATATTTTGGAAGAACAATACGCGTGAGTGGCCAATCTCTATTCACGTTGCACAGCTGACCGG
CCTCGTTTTAAAGTTACATGTGCGATCTCAAAAGTACAGGCTGGGTGTTCTTGCTTCATTTATAAAACGCTCTCA
TTTGGCGGCTAACGTGCGTGTTATTGCTCCAGAGACTCTCGAAGCAGGCGGTCATTGCGTTCTCGAAATGCCTTC
AGGAACCGGCAAAACGGTGTCCCTACTCTCCTTGATCGTCGCATATCAACAAAATATGCCGGAACGTCGAAAGCT
CATATACTGCTCACGTATGATATCACACTACAGTATCTCATCTGTACGTTCCAGCTTAATAATCACGCAGGAACC
ATGTCCGAGATCGAAAAGGCGCTGGTCGAGCTGAAGTCGCTGATGAAATATCGGGCAGAACAACTTGGGTACGAA
GAGGATTTTCGGGGTCTCGGACTGACTAGTCGAAAGAATCTCTGCCTGCATCCATCAGTCAAGCGGGAGAAGAGT
GGATCAATTGTCGACGCTCGCTGCAGGAGCTTAACGGCCGGTTTTGTAAGAGAGAAGAAGGAAAAGGGGGAGAAT
GTTCAGGTCTGCATCTATCACGATGTGAGATTGAAGTCCACCAATTCCTACCTCTCAAATACCTCTGACTTCATT
CTAGAATCTTGATCTCCTGGAACCACACAACTTGATACCCAATGGAGTTTGGACCTTTGACGGGATCCTTCGATA
CGGGGAGGAACACAAACAATGCCCCTATTTCACGGCACGAAGGATGGTTGGTGATCACGCAGGCCGGGGATGGAC
ATTTTCTAATCCAAATCCTCAGATGCAATACTGCAACGTTGTCATCTTCTCGTACCACTATATGCTGGATCCCAA
GATTGCCGAGCGAGTTTCGCGAGACTTTTCCAAGGACTGCATTGTGGTCTTTGACGAAGCACACAACATCGACAA
CGTGTGCATTGAATCCCTTAGCACGGACATCACTGAAGATTCTCTGCGGAAAGCATCACGCGGAGCGCAAAACCT
TGAGAGGAAGATTGCTGAGATGCGGGACACAGACCAGGAGCAATTGCAGAATGAATACCAAAAGCTCGTTCAAGG
CCTTAGGGATGCTGATGAAGCCCGACAGGAGGACGCGTTCGCGTCTAATCCTGGTGAGACCCGCATACCTTGGCC
CTTCTCTGGCGGACTAACACGTTTCGCAGCTCTCCCCGAAGATCTTCTCAAAGAAGCCGTGCCTGGAAACATAAG
GCGAGCTGAACATTTTGTCGCCTTCTTGAAGCGATTTATAGAATATCTCAAGGTGATCTCACATCCTTCACTAAA
CGATCTTGGAGCTAACTAGTGGTAGACCCGGATGAGAGTCCGCCAGGTCATCTCCGAAACGCCCCCTTCCTTCTT
GGGTCATCTCAAGGAACACACATTCATCGAAAGGAAGCCCTTGAGGTTCTGTGCGGAGCGCCTAACGTCACTCGC
GCGGACCCTGGAGTTGACAAACATAGAAGACTACCATCCACTACAGGAGGTGGCTACGTTTGCGACACTGGTGGC
AACCTATGAGAAGGGCTTCTTGCTGATTTTGGAACCGTACGAATCGGATACTGCTGAGGTTCCCAATCCCATATT
CCATTTTACCTGCCTAGATGCGGCCATTGCAATCCGGCCGGTGTTCGAAAGATTCTACTCAGTCATCATCACGTC
GGGTACTATCTCGCCCCTCGAGATGTATCCCAAGATGCTAGACTTTTCGACCGTCATCCAAGAGTCTTACAGCAT
GACTCTGGCGCGAAGGTCGTTTTTACCCATGATAGTCACTCGCGGCAGTGACCAGGCCTCTGTTTCGACCAGCTT
CCAGGTCAGAAACGAGCCAAGCGTGGTGCGTAACTACGGCACACTTTTGACGGAATTTGCCAAAATCACACCCGA
CGGCGTGGTGGTATTTTTCCCGTCCTACCTCTACATGGAATCCATCATTAGCATGTGGCAGGGAATGGGCATCCT
GGATGAGGTCTGGAAGTACAAGTTGATCCTAGTGGAAACGCCCGACGCGCAGGAGACATCGCTGGCTCTTGAGAC
GTACCGAACCGCGTGCTGCAACGGAAGGGGTGCAATTCTCCTATGTGTGGCCCGGGGAAAGGTTTCGGAGGGTAT
CGATTTTGATCACCAGTACGGACGCACGGTGCTTTGCATTGGAGTTCCTTTCCAGTACACCGAGTCACGGATACT
CAAGGCGAGGCTCGAGTTTCTACGGGAGACTTACCGCATCAGAGAAAATGACTTTCTATCCTTCGATGCCATGCG
CCATGCCGCGCAGTGTCTCGGACGAGTGCTGCGAGGCAAGGATGATTATGGAATCATGGTGCTTGCCGACCGCCG
CTTTCAGAAGAAGAGGACGCAGTTGCCGAAGTGGATCAACCAGGGACTGCTAGACGCCGATGTCAACCTGAGCAC
CGATATGGCAGTCTCCAGCGCCAGGAAATTCCTCAAGACAATGGCTCAGCCGTTTCGTGCCAAGGACCAAGAAGG
CATTAGTACATGGGGACTCGATGACCTGAGGAGACACAGGGAGAAGATGGACATGGATAAGCGTCTTGAGCCGGA
AGATCCTAGCGGAGGTTCAATGGGCCGTGATATCTCTACCGTCGACGGTTTGGAGTTTGACGACCAGGCCTTTGA
CGAGGAAATGATGGACATGGATGGTTTCTAAGATGGACGATTATCCAGGCTGCATACCCTCCAACACGTAGGATT
CGGGGGTCCCTTTTGGGACTAAACACCCAACAAATACTCTTCTTTACCGCTAACTACAGGTATCATCGCATCCTT
TTCTGGAGTTACGGGTTTTGCGTTGATCATCGTCGCCCAGGGCAACCCAAGAGGTCATACCCCTTCAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail