Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6509
Gene name
Locationscaffold_572:2035..3083
Strand-
Gene length (bp)1048
Transcript length (bp)972
Coding sequence length (bp)969
Protein length (aa) 323

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13622 4HBT_3 Thioesterase-like superfamily 8.0E-45 28 309

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Peroxisome Peroxisomal targeting signal 0.1959 0.305 0.0431 0.016 0.45 0.035 0.2643 0.0286 0.1256 0.9079

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup752
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|971
Ophiocordyceps australis map64 (Brazil) OphauB2|7292
Ophiocordyceps camponoti-floridani Ophcf2|01300
Ophiocordyceps camponoti-rufipedis Ophun1|2654
Ophiocordyceps kimflemingae Ophio5|2780
Ophiocordyceps kimflemingae Ophio5|6509 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2211
Ophiocordyceps subramaniannii Hirsu2|7132

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6509
MTMTTSDSLAKATTVTQLDATTFAATLQPAFCFGSVPNGGYVASIFHNAARAFMATRGGRQTDVIAVHWQFLSRT
QAGPAVFKVMEAKSGRAVSVLHLKLLQHGLLSRAPWCDEATSSSLVVAYVTCAAMDAEVGVSLPTGWLLSTPPPP
VDLAELVRDREPNWRRMWTLLMDRHPLFFRKIDMYMPRHGHGLPATQDLWIRLASGEPFTDTALGFVADVAAPLL
IEAFRPTSPDAPVPPAGFAYSDSFWFPTLTMSLDVKKRLPWAGAEWLRLHAEASVIRNGRFDSRFFIFDRDGDLV
AWSSQVAMVVDYGRNQAKRTTKM
Coding >Ophio5|6509
ATGACCATGACGACCTCCGATTCGCTAGCCAAAGCTACAACCGTCACGCAGCTGGACGCGACGACCTTTGCCGCC
ACTCTGCAGCCGGCCTTTTGCTTTGGGTCCGTGCCCAACGGCGGCTACGTCGCCTCCATCTTCCACAATGCCGCC
CGGGCCTTCATGGCTACGCGGGGAGGGCGGCAGACGGACGTCATCGCCGTCCACTGGCAGTTCCTGTCCCGGACC
CAGGCCGGCCCCGCCGTCTTCAAGGTGATGGAGGCCAAGTCCGGCCGCGCCGTGTCGGTTCTGCACTTGAAGCTA
CTGCAGCATGGCTTACTGTCTAGGGCACCGTGGTGTGACGAGGCGACGTCGTCGTCCTTGGTCGTCGCTTACGTT
ACCTGCGCCGCCATGGACGCCGAGGTTGGTGTCAGCTTGCCTACCGGTTGGCTCTTGTCCACGCCGCCTCCGCCC
GTGGACCTGGCAGAGCTTGTCCGAGATCGGGAGCCGAACTGGCGTCGGATGTGGACCTTGCTCATGGACCGTCAT
CCCTTGTTTTTTCGCAAGATTGACATGTACATGCCGCGCCACGGACATGGTCTACCGGCGACGCAGGATCTCTGG
ATTCGCCTGGCATCCGGTGAGCCCTTTACCGACACGGCCTTGGGCTTCGTCGCCGATGTGGCCGCTCCCTTGCTC
ATCGAGGCCTTCCGTCCGACTTCGCCCGACGCTCCCGTGCCACCGGCCGGCTTCGCCTACTCCGACAGCTTCTGG
TTTCCGACCTTGACCATGAGCCTCGATGTCAAGAAGCGGCTGCCTTGGGCCGGTGCCGAGTGGCTGCGTCTACAC
GCCGAGGCTTCTGTCATTCGTAACGGCCGCTTCGACTCGCGTTTCTTCATCTTTGATCGTGACGGCGACTTGGTC
GCCTGGAGCAGCCAGGTCGCCATGGTGGTGGACTATGGAAGAAACCAGGCCAAGCGGACGACCAAGATG
Transcript >Ophio5|6509
ATGACCATGACGACCTCCGATTCGCTAGCCAAAGCTACAACCGTCACGCAGCTGGACGCGACGACCTTTGCCGCC
ACTCTGCAGCCGGCCTTTTGCTTTGGGTCCGTGCCCAACGGCGGCTACGTCGCCTCCATCTTCCACAATGCCGCC
CGGGCCTTCATGGCTACGCGGGGAGGGCGGCAGACGGACGTCATCGCCGTCCACTGGCAGTTCCTGTCCCGGACC
CAGGCCGGCCCCGCCGTCTTCAAGGTGATGGAGGCCAAGTCCGGCCGCGCCGTGTCGGTTCTGCACTTGAAGCTA
CTGCAGCATGGCTTACTGTCTAGGGCACCGTGGTGTGACGAGGCGACGTCGTCGTCCTTGGTCGTCGCTTACGTT
ACCTGCGCCGCCATGGACGCCGAGGTTGGTGTCAGCTTGCCTACCGGTTGGCTCTTGTCCACGCCGCCTCCGCCC
GTGGACCTGGCAGAGCTTGTCCGAGATCGGGAGCCGAACTGGCGTCGGATGTGGACCTTGCTCATGGACCGTCAT
CCCTTGTTTTTTCGCAAGATTGACATGTACATGCCGCGCCACGGACATGGTCTACCGGCGACGCAGGATCTCTGG
ATTCGCCTGGCATCCGGTGAGCCCTTTACCGACACGGCCTTGGGCTTCGTCGCCGATGTGGCCGCTCCCTTGCTC
ATCGAGGCCTTCCGTCCGACTTCGCCCGACGCTCCCGTGCCACCGGCCGGCTTCGCCTACTCCGACAGCTTCTGG
TTTCCGACCTTGACCATGAGCCTCGATGTCAAGAAGCGGCTGCCTTGGGCCGGTGCCGAGTGGCTGCGTCTACAC
GCCGAGGCTTCTGTCATTCGTAACGGCCGCTTCGACTCGCGTTTCTTCATCTTTGATCGTGACGGCGACTTGGTC
GCCTGGAGCAGCCAGGTCGCCATGGTGGTGGACTATGGAAGAAACCAGGCCAAGCGGACGACCAAGATGTGA
Gene >Ophio5|6509
ATGACCATGACGACCTCCGATTCGCTAGCCAAAGCTACAACCGTCACGCAGCTGGACGCGACGACCTTTGCCGCC
ACTCTGCAGCCGGCCTTTTGCTTTGGGTCCGGTGAGTCCAGTCCCCCCCCCACCTCCACGGGCTGTGTTGCCGAG
GCGGGTGACGGCGGGCTCAGCGCCGGCGCCAGTGCCCAACGGCGGCTACGTCGCCTCCATCTTCCACAATGCCGC
CCGGGCCTTCATGGCTACGCGGGGAGGGCGGCAGACGGACGTCATCGCCGTCCACTGGCAGTTCCTGTCCCGGAC
CCAGGCCGGCCCCGCCGTCTTCAAGGTGATGGAGGCCAAGTCCGGCCGCGCCGTGTCGGTTCTGCACTTGAAGCT
ACTGCAGCATGGCTTACTGTCTAGGGCACCGTGGTGTGACGAGGCGACGTCGTCGTCCTTGGTCGTCGCTTACGT
TACCTGCGCCGCCATGGACGCCGAGGTTGGTGTCAGCTTGCCTACCGGTTGGCTCTTGTCCACGCCGCCTCCGCC
CGTGGACCTGGCAGAGCTTGTCCGAGATCGGGAGCCGAACTGGCGTCGGATGTGGACCTTGCTCATGGACCGTCA
TCCCTTGTTTTTTCGCAAGATTGACATGTACATGCCGCGCCACGGACATGGTCTACCGGCGACGCAGGATCTCTG
GATTCGCCTGGCATCCGGTGAGCCCTTTACCGACACGGCCTTGGGCTTCGTCGCCGATGTGGCCGCTCCCTTGCT
CATCGAGGCCTTCCGTCCGACTTCGCCCGACGCTCCCGTGCCACCGGCCGGCTTCGCCTACTCCGACAGCTTCTG
GTTTCCGACCTTGACCATGAGCCTCGATGTCAAGAAGCGGCTGCCTTGGGCCGGTGCCGAGTGGCTGCGTCTACA
CGCCGAGGCTTCTGTCATTCGTAACGGCCGCTTCGACTCGCGTTTCTTCATCTTTGATCGTGACGGCGACTTGGT
CGCCTGGAGCAGCCAGGTCGCCATGGTGGTGGACTATGGAAGAAACCAGGCCAAGCGGACGACCAAGATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail