Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6507
Gene name
Locationscaffold_571:7875..8836
Strand-
Gene length (bp)961
Transcript length (bp)840
Coding sequence length (bp)837
Protein length (aa) 279

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01184 Gpr1_Fun34_YaaH GPR1/FUN34/yaaH family 8.3E-87 50 262

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B2K4|ACPA_EMENI Acetate permease A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acpA PE=2 SV=1 25 277 1.0E-76
sp|P32907|ATO2_YEAST Ammonia transport outward protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATO2 PE=1 SV=1 50 266 2.0E-57
sp|O14201|MUG86_SCHPO Meiotically up-regulated gene 86 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug86 PE=1 SV=1 57 276 5.0E-56
sp|P41943|GPR1_YARLI Glyoxylate pathway regulator OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GPR1 PE=1 SV=3 7 265 9.0E-50
sp|P25613|ADY2_YEAST Accumulation of dyads protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADY2 PE=1 SV=1 50 266 4.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B2K4|ACPA_EMENI Acetate permease A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acpA PE=2 SV=1 25 277 1.0E-76
sp|P32907|ATO2_YEAST Ammonia transport outward protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATO2 PE=1 SV=1 50 266 2.0E-57
sp|O14201|MUG86_SCHPO Meiotically up-regulated gene 86 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug86 PE=1 SV=1 57 276 5.0E-56
sp|P41943|GPR1_YARLI Glyoxylate pathway regulator OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GPR1 PE=1 SV=3 7 265 9.0E-50
sp|P25613|ADY2_YEAST Accumulation of dyads protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADY2 PE=1 SV=1 50 266 4.0E-49
sp|Q12359|ATO3_YEAST Ammonia transport outward protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATO3 PE=1 SV=1 48 253 2.0E-27
sp|P0ACA0|SATP_SHIFL Succinate-acetate/proton symporter SatP OS=Shigella flexneri GN=satP PE=3 SV=1 62 210 5.0E-21
sp|P0AC98|SATP_ECOLI Succinate-acetate/proton symporter SatP OS=Escherichia coli (strain K12) GN=satP PE=1 SV=1 62 210 5.0E-21
sp|P0AC99|SATP_ECO57 Succinate-acetate/proton symporter SatP OS=Escherichia coli O157:H7 GN=satP PE=3 SV=1 62 210 5.0E-21
sp|O26317|Y215_METTH Uncharacterized protein MTH_215 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_215 PE=3 SV=1 64 204 3.0E-16
sp|Q24JP1|ALCS_ASPFU Protein alcS OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alcS PE=3 SV=1 63 272 3.0E-12
sp|B0YBR5|ALCS_ASPFC Protein alcS OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=alcS PE=3 SV=2 63 272 3.0E-12
sp|Q460G9|ALCS_EMENI Protein alcS OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alcS PE=2 SV=1 58 257 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 66 88 22
2 98 117 19
3 129 151 22
4 161 183 22
5 188 210 22
6 220 242 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6507
MSAENASRAPSLEKELPSGAPAGAGAGPIHRHHHHDYSHMSPAFSGANAGALQPGLWKPYEHRKLANPAPLGLSA
FALTTFVLSAINMHARGVSQPNIVVSIAFGYGGLVQLLAGMWEVACGNTFGATAFSSYGGFWISYAIILTPTWGI
TSPDGPYHGNVASPIGFFLTGWFIFTTLLLLCTLRSTVTLFLLFFFLDLAFLFLATEQYALDVGNKSLGLVLQKT
GGAFGFASAFLAWYNALAGIQDSSNSFFQVPVLHFPWSDKVRERRAHKSDRSQA
Coding >Ophio5|6507
ATGTCAGCCGAGAACGCGAGCCGCGCTCCGTCGCTGGAAAAGGAGCTCCCCAGTGGCGCTCCGGCCGGCGCCGGC
GCCGGCCCCATTCACCGCCATCATCATCATGACTACTCTCACATGTCTCCGGCCTTCTCCGGAGCAAACGCCGGC
GCCTTGCAGCCCGGCCTCTGGAAGCCGTACGAGCACCGCAAGCTGGCCAATCCGGCACCCCTCGGCCTCAGCGCC
TTTGCCCTCACCACATTCGTACTGTCCGCTATCAACATGCACGCCCGTGGCGTGTCTCAGCCCAATATAGTCGTC
TCCATTGCCTTTGGCTACGGCGGTCTCGTCCAGCTTCTCGCCGGCATGTGGGAGGTTGCTTGCGGGAACACGTTC
GGCGCCACGGCCTTCTCTTCCTATGGCGGCTTCTGGATCTCGTACGCCATCATCCTCACCCCGACTTGGGGTATC
ACCTCGCCCGACGGGCCGTACCATGGCAATGTCGCCAGCCCCATTGGCTTCTTCCTCACCGGCTGGTTCATCTTC
ACCACGCTGCTGTTGCTCTGCACACTTCGATCTACTGTCACGCTCTTTCTACTCTTCTTCTTCCTCGATCTGGCC
TTTCTCTTCCTCGCCACCGAGCAGTACGCCCTGGACGTCGGCAACAAGAGCCTCGGCCTCGTTCTGCAGAAGACA
GGGGGCGCCTTCGGCTTCGCGAGCGCTTTCCTGGCCTGGTACAATGCGCTGGCCGGCATCCAGGACAGCAGCAAT
TCATTCTTCCAAGTGCCCGTCTTGCACTTCCCTTGGTCCGACAAGGTTCGCGAACGCCGCGCGCACAAGAGTGAT
CGCTCTCAGGCC
Transcript >Ophio5|6507
ATGTCAGCCGAGAACGCGAGCCGCGCTCCGTCGCTGGAAAAGGAGCTCCCCAGTGGCGCTCCGGCCGGCGCCGGC
GCCGGCCCCATTCACCGCCATCATCATCATGACTACTCTCACATGTCTCCGGCCTTCTCCGGAGCAAACGCCGGC
GCCTTGCAGCCCGGCCTCTGGAAGCCGTACGAGCACCGCAAGCTGGCCAATCCGGCACCCCTCGGCCTCAGCGCC
TTTGCCCTCACCACATTCGTACTGTCCGCTATCAACATGCACGCCCGTGGCGTGTCTCAGCCCAATATAGTCGTC
TCCATTGCCTTTGGCTACGGCGGTCTCGTCCAGCTTCTCGCCGGCATGTGGGAGGTTGCTTGCGGGAACACGTTC
GGCGCCACGGCCTTCTCTTCCTATGGCGGCTTCTGGATCTCGTACGCCATCATCCTCACCCCGACTTGGGGTATC
ACCTCGCCCGACGGGCCGTACCATGGCAATGTCGCCAGCCCCATTGGCTTCTTCCTCACCGGCTGGTTCATCTTC
ACCACGCTGCTGTTGCTCTGCACACTTCGATCTACTGTCACGCTCTTTCTACTCTTCTTCTTCCTCGATCTGGCC
TTTCTCTTCCTCGCCACCGAGCAGTACGCCCTGGACGTCGGCAACAAGAGCCTCGGCCTCGTTCTGCAGAAGACA
GGGGGCGCCTTCGGCTTCGCGAGCGCTTTCCTGGCCTGGTACAATGCGCTGGCCGGCATCCAGGACAGCAGCAAT
TCATTCTTCCAAGTGCCCGTCTTGCACTTCCCTTGGTCCGACAAGGTTCGCGAACGCCGCGCGCACAAGAGTGAT
CGCTCTCAGGCCTGA
Gene >Ophio5|6507
ATGTCAGCCGAGAACGCGAGCCGCGCTCCGTCGCTGGAAAAGGAGCTCCCCAGTGGCGCTCCGGCCGGCGCCGGC
GCCGGCCCCATTCACCGCCATCATCATCATGACTACTCTCACATGTCTCCGGCCTTCTCCGGAGCAAACGCCGGC
GCCTTGCAGCCCGGCCTCTGGAAGCCGTACGAGCACCGCAAGCTGGCCAATCCGGCACCCCTCGGCCTCAGCGCC
TTTGCCCTCACCACATTCGTACTGTCCGCTATCAACATGCACGCCCGTGGCGTGTCTCAGCCCAATATAGTCGTC
TCCATTGCCTTTGGCTACGGCGGTCTCGTCCAGCTTCTCGCCGGCATGTGGTCTGTCGCCCTCTTTTTGGTTCTC
CCGTGAAGACGCTGCTGACCCTCTCCCCCCCCCTTCACAGGGAGGTTGCTTGCGGGAACACGTTCGGCGCCACGG
CCTTCTCTTCCTATGGCGGCTTCTGGATCTCGTACGCCATCATCCTCACCCCGACTTGGGGTATCACCTCGCCCG
ACGGGCCGTACCATGGCAATGTCGCCAGCCCCATTGGCTTCTTCCTCACCGGCTGGTTCATCTTCACCACGCTGC
TGTTGCTCTGCACACTTCGATCTACTGTCACGCTCTTTCTACTCTTCTTCTTCCTCGATCTGGCCTTTCTCTTCC
TCGCCACCGAGCAGTACGCCCTGGACGTCGGCAACAAGAGCCTCGGCCTCGTTCTGCAGAAGACAGGGGGCGCCT
TCGGCTTCGCGAGCGCTTTCCTGGCCTGGTACAATGCGCTGGCCGGCATCCAGGACAGCAGGTTAGTTGCTCAGG
CCTTCCAGGCTGTGAGAGCGGCGGATTGACTAGGCCCTACAGCAATTCATTCTTCCAAGTGCCCGTCTTGCACTT
CCCTTGGTCCGACAAGGTTCGCGAACGCCGCGCGCACAAGAGTGATCGCTCTCAGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail