Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6501
Gene name
Locationscaffold_570:1291..2533
Strand+
Gene length (bp)1242
Transcript length (bp)1059
Coding sequence length (bp)1056
Protein length (aa) 352

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01151 ELO GNS1/SUR4 family 3.3E-65 52 292

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTF7|ELOH1_SCHPO Putative elongation of fatty acids protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B2.03c PE=1 SV=1 14 299 1.0E-104
sp|P25358|ELO2_YEAST Elongation of fatty acids protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELO2 PE=1 SV=1 13 295 1.0E-103
sp|P40319|ELO3_YEAST Elongation of fatty acids protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELO3 PE=1 SV=1 1 287 5.0E-99
sp|P39540|ELO1_YEAST Elongation of fatty acids protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELO1 PE=1 SV=1 14 298 8.0E-96
sp|Q7LKX0|ELOH2_SCHPO Putative elongation of fatty acids protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1639.01c PE=3 SV=3 24 287 2.0E-81
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTF7|ELOH1_SCHPO Putative elongation of fatty acids protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B2.03c PE=1 SV=1 14 299 1.0E-104
sp|P25358|ELO2_YEAST Elongation of fatty acids protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELO2 PE=1 SV=1 13 295 1.0E-103
sp|P40319|ELO3_YEAST Elongation of fatty acids protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELO3 PE=1 SV=1 1 287 5.0E-99
sp|P39540|ELO1_YEAST Elongation of fatty acids protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELO1 PE=1 SV=1 14 298 8.0E-96
sp|Q7LKX0|ELOH2_SCHPO Putative elongation of fatty acids protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1639.01c PE=3 SV=3 24 287 2.0E-81
sp|Q86JM5|Y2012_DICDI Putative elongation of fatty acids protein DDB_G0272012 OS=Dictyostelium discoideum GN=DDB_G0272012 PE=3 SV=1 27 230 2.0E-35
sp|Q54CJ4|ELOA_DICDI Elongation of fatty acids protein A OS=Dictyostelium discoideum GN=eloA PE=2 SV=1 41 287 5.0E-30
sp|Q54TC9|SRE1_DICDI Elongation of fatty acids protein sre1 OS=Dictyostelium discoideum GN=sre1 PE=2 SV=1 40 292 4.0E-23
sp|Q555E8|Y4669_DICDI Putative elongation of fatty acids protein DDB_G0274669 OS=Dictyostelium discoideum GN=DDB_G0274669 PE=3 SV=1 27 230 4.0E-23
sp|Q20303|ELO6_CAEEL Elongation of very long chain fatty acids protein 6 OS=Caenorhabditis elegans GN=elo-6 PE=1 SV=1 65 291 4.0E-20
sp|Q8BHI7|ELOV5_MOUSE Elongation of very long chain fatty acids protein 5 OS=Mus musculus GN=Elovl5 PE=1 SV=1 63 349 4.0E-18
sp|Q9GZR5|ELOV4_HUMAN Elongation of very long chain fatty acids protein 4 OS=Homo sapiens GN=ELOVL4 PE=1 SV=1 44 328 5.0E-18
sp|P49191|ELO3_CAEEL Putative fatty acid elongation protein 3 OS=Caenorhabditis elegans GN=elo-3 PE=1 SV=2 45 324 5.0E-18
sp|Q9NYP7|ELOV5_HUMAN Elongation of very long chain fatty acids protein 5 OS=Homo sapiens GN=ELOVL5 PE=1 SV=1 58 326 2.0E-17
sp|Q3S8M4|ELOV4_MACMU Elongation of very long chain fatty acids protein 4 OS=Macaca mulatta GN=ELOVL4 PE=3 SV=1 44 352 2.0E-17
sp|Q95K73|ELOV4_MACFA Elongation of very long chain fatty acids protein 4 OS=Macaca fascicularis GN=ELOVL4 PE=2 SV=1 44 352 2.0E-17
sp|Q5ZJR8|ELOV6_CHICK Elongation of very long chain fatty acids protein 6 OS=Gallus gallus GN=ELOVL6 PE=2 SV=1 56 298 6.0E-17
sp|Q920L7|ELOV5_RAT Elongation of very long chain fatty acids protein 5 OS=Rattus norvegicus GN=Elovl5 PE=1 SV=1 64 349 7.0E-17
sp|Q4R516|ELOV5_MACFA Elongation of very long chain fatty acids protein 5 OS=Macaca fascicularis GN=ELOVL5 PE=2 SV=1 58 330 2.0E-16
sp|Q9EQC4|ELOV4_MOUSE Elongation of very long chain fatty acids protein 4 OS=Mus musculus GN=Elovl4 PE=1 SV=2 49 346 3.0E-16
sp|Q920L5|ELOV6_MOUSE Elongation of very long chain fatty acids protein 6 OS=Mus musculus GN=Elovl6 PE=1 SV=1 56 296 3.0E-16
sp|Q5M8U1|ELOV5_XENTR Elongation of very long chain fatty acids protein 5 OS=Xenopus tropicalis GN=elovl5 PE=2 SV=1 58 289 3.0E-16
sp|Q9H5J4|ELOV6_HUMAN Elongation of very long chain fatty acids protein 6 OS=Homo sapiens GN=ELOVL6 PE=1 SV=1 56 298 5.0E-16
sp|Q2KJD9|ELOV5_BOVIN Elongation of very long chain fatty acids protein 5 OS=Bos taurus GN=ELOVL5 PE=2 SV=1 58 324 5.0E-16
sp|Q5RFL5|ELOV5_PONAB Elongation of very long chain fatty acids protein 5 OS=Pongo abelii GN=ELOVL5 PE=2 SV=1 58 330 8.0E-16
sp|Q32NI8|ELOV5_XENLA Elongation of very long chain fatty acids protein 5 OS=Xenopus laevis GN=elovl5 PE=2 SV=1 58 289 8.0E-16
sp|Q9JLJ4|ELOV2_MOUSE Elongation of very long chain fatty acids protein 2 OS=Mus musculus GN=Elovl2 PE=1 SV=1 58 289 3.0E-15
sp|Q20300|ELO5_CAEEL Elongation of very long chain fatty acids protein 5 OS=Caenorhabditis elegans GN=elo-5 PE=1 SV=1 58 291 3.0E-15
sp|D4A612|ELOV2_RAT Elongation of very long chain fatty acids protein 2 OS=Rattus norvegicus GN=Elovl2 PE=1 SV=1 63 289 5.0E-15
sp|Q920L6|ELOV6_RAT Elongation of very long chain fatty acids protein 6 OS=Rattus norvegicus GN=Elovl6 PE=1 SV=1 56 215 2.0E-14
sp|Q9NXB9|ELOV2_HUMAN Elongation of very long chain fatty acids protein 2 OS=Homo sapiens GN=ELOVL2 PE=1 SV=2 58 352 2.0E-14
sp|A1L3X0|ELOV7_HUMAN Elongation of very long chain fatty acids protein 7 OS=Homo sapiens GN=ELOVL7 PE=1 SV=1 53 231 9.0E-14
sp|Q6PC64|ELOV6_DANRE Elongation of very long chain fatty acids protein 6 OS=Danio rerio GN=elovl6 PE=2 SV=1 56 299 1.0E-13
sp|A0JNC4|ELOV7_BOVIN Elongation of very long chain fatty acids protein 7 OS=Bos taurus GN=ELOVL7 PE=2 SV=1 53 231 4.0E-13
sp|D4ADY9|ELOV7_RAT Elongation of very long chain fatty acids protein 7 OS=Rattus norvegicus GN=Elovl7 PE=3 SV=1 53 243 4.0E-13
sp|Q9D2Y9|ELOV7_MOUSE Elongation of very long chain fatty acids protein 7 OS=Mus musculus GN=Elovl7 PE=2 SV=1 53 243 5.0E-13
sp|Q9JLJ5|ELOV1_MOUSE Elongation of very long chain fatty acids protein 1 OS=Mus musculus GN=Elovl1 PE=1 SV=1 53 231 8.0E-13
sp|Q9BW60|ELOV1_HUMAN Elongation of very long chain fatty acids protein 1 OS=Homo sapiens GN=ELOVL1 PE=1 SV=1 53 231 4.0E-12
sp|Q03574|ELO4_CAEEL Putative fatty acid elongation protein 4 OS=Caenorhabditis elegans GN=elo-4 PE=3 SV=1 63 222 2.0E-11
sp|O35949|ELOV3_MOUSE Elongation of very long chain fatty acids protein 3 OS=Mus musculus GN=Elovl3 PE=1 SV=1 72 235 2.0E-09
sp|Q9HB03|ELOV3_HUMAN Elongation of very long chain fatty acids protein 3 OS=Homo sapiens GN=ELOVL3 PE=1 SV=2 63 289 7.0E-09
sp|Q1HRV8|ELVL1_AEDAE Elongation of very long chain fatty acids protein AAEL008004 OS=Aedes aegypti GN=AAEL008004 PE=2 SV=2 49 352 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0009922 fatty acid elongase activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0016746 acyltransferase activity No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0004312 fatty acid synthase activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.5

Transmembrane Domains

Domain # Start End Length
1 50 72 22
2 93 115 22
3 185 207 22
4 226 248 22
5 263 285 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 15.86 6.06 25.66
CcL In ants, during behavior modification 82.52 43.04 121.99
CcD In ants, recently dead 77.33 42.37 112.29

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.817777 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6501
MSSPSSFYEQLPLPTLERPFGIRLWPFFDKAWTAVVGYPTERFNFVPFETPMSTLKSTAIFIVIYYAVIFGGREL
MRKREPLQLKTIFLIHNLYLTIISGVLLVLFIEQLLATVVRRGVFYTICNRDGGWTQPLVVLYYLNYLTKYLELL
DTVFLFLKKKPLTFLHCYHHGATALLCYTQLVGSTAVSWVPITLNLTVHVVMYWYYFQSARGVRVWWKEWVTRLQ
IVQFIIDLFFVYFASYTYFTSTYFPSLPNQGTCAGEEFAAFCGIAILSSYLVLFISFYFATYKKCGKATTSCKSL
RRMSQAPLPDPLHLQAAMNGINGNANGNGNGVHVTGSKSNGTTPNGTRSRKA
Coding >Ophio5|6501
ATGTCGTCTCCCTCATCCTTCTACGAGCAGTTGCCGCTGCCGACACTCGAGCGTCCCTTCGGCATTCGTCTGTGG
CCCTTTTTCGACAAGGCATGGACCGCCGTCGTCGGATACCCGACCGAGCGCTTCAACTTCGTGCCCTTCGAGACG
CCCATGTCAACGCTCAAGTCGACGGCCATCTTCATCGTCATCTACTATGCCGTCATCTTTGGCGGCCGCGAGCTG
ATGCGCAAACGCGAGCCTCTCCAGCTCAAGACCATCTTCCTCATCCACAACCTCTACCTGACCATTATTAGCGGC
GTCCTCCTCGTCCTCTTCATCGAACAGCTACTCGCCACCGTCGTCCGCCGCGGCGTCTTCTACACCATCTGCAAT
CGCGATGGCGGTTGGACCCAGCCCCTTGTTGTCCTATACTATCTCAATTACCTCACCAAATATCTCGAGCTGCTC
GACACCGTCTTCCTCTTTCTCAAGAAGAAGCCTTTGACCTTCCTGCATTGCTACCATCATGGCGCCACCGCCCTC
CTTTGCTACACGCAGCTTGTCGGCTCCACGGCCGTTTCATGGGTCCCCATCACGCTCAACTTGACGGTGCACGTC
GTCATGTACTGGTACTACTTCCAGAGTGCGCGCGGTGTCCGCGTGTGGTGGAAGGAGTGGGTGACGCGCCTCCAG
ATTGTCCAGTTCATCATCGATCTATTCTTCGTCTACTTTGCCTCTTACACGTACTTTACGTCGACGTATTTCCCG
TCCCTGCCCAACCAAGGCACGTGCGCGGGAGAGGAGTTTGCGGCTTTCTGCGGCATTGCCATCTTGAGCTCTTAC
CTAGTGCTCTTCATCTCCTTCTACTTTGCCACGTACAAGAAGTGCGGCAAGGCGACGACGAGCTGCAAGTCGCTC
CGTCGCATGAGCCAAGCGCCGCTCCCCGACCCGCTGCATCTGCAAGCGGCCATGAACGGCATCAACGGCAACGCC
AATGGCAACGGCAACGGCGTCCATGTGACGGGGTCCAAGTCCAACGGCACCACGCCCAACGGCACCCGTTCTCGC
AAAGCT
Transcript >Ophio5|6501
ATGTCGTCTCCCTCATCCTTCTACGAGCAGTTGCCGCTGCCGACACTCGAGCGTCCCTTCGGCATTCGTCTGTGG
CCCTTTTTCGACAAGGCATGGACCGCCGTCGTCGGATACCCGACCGAGCGCTTCAACTTCGTGCCCTTCGAGACG
CCCATGTCAACGCTCAAGTCGACGGCCATCTTCATCGTCATCTACTATGCCGTCATCTTTGGCGGCCGCGAGCTG
ATGCGCAAACGCGAGCCTCTCCAGCTCAAGACCATCTTCCTCATCCACAACCTCTACCTGACCATTATTAGCGGC
GTCCTCCTCGTCCTCTTCATCGAACAGCTACTCGCCACCGTCGTCCGCCGCGGCGTCTTCTACACCATCTGCAAT
CGCGATGGCGGTTGGACCCAGCCCCTTGTTGTCCTATACTATCTCAATTACCTCACCAAATATCTCGAGCTGCTC
GACACCGTCTTCCTCTTTCTCAAGAAGAAGCCTTTGACCTTCCTGCATTGCTACCATCATGGCGCCACCGCCCTC
CTTTGCTACACGCAGCTTGTCGGCTCCACGGCCGTTTCATGGGTCCCCATCACGCTCAACTTGACGGTGCACGTC
GTCATGTACTGGTACTACTTCCAGAGTGCGCGCGGTGTCCGCGTGTGGTGGAAGGAGTGGGTGACGCGCCTCCAG
ATTGTCCAGTTCATCATCGATCTATTCTTCGTCTACTTTGCCTCTTACACGTACTTTACGTCGACGTATTTCCCG
TCCCTGCCCAACCAAGGCACGTGCGCGGGAGAGGAGTTTGCGGCTTTCTGCGGCATTGCCATCTTGAGCTCTTAC
CTAGTGCTCTTCATCTCCTTCTACTTTGCCACGTACAAGAAGTGCGGCAAGGCGACGACGAGCTGCAAGTCGCTC
CGTCGCATGAGCCAAGCGCCGCTCCCCGACCCGCTGCATCTGCAAGCGGCCATGAACGGCATCAACGGCAACGCC
AATGGCAACGGCAACGGCGTCCATGTGACGGGGTCCAAGTCCAACGGCACCACGCCCAACGGCACCCGTTCTCGC
AAAGCTTAG
Gene >Ophio5|6501
ATGTCGTCTCCCTCATCCTTCTACGAGCAGTTGCCGCTGCCGACACTCGAGCGTCCCTTCGGCATTCGTCTGTGG
CCCTTTTTCGACAAGGCATGGACCGCCGTCGTCGGATACCCGACCGAGCGCTTCAACTTCGTGCCCTTCGAGACG
CCCATGTCAACGCTCAAGTCGACGGCCATCTTCATCGTCATCTACTATGCCGTCATCTTTGGCGGCCGCGAGCTG
ATGCGCAAACGCGAGCCTCTCCAGCTCAAGACCATCTTCCTCATCCACAACCTCTACCTGACCATTATTAGCGGC
GTCCTCCTCGTCCTCTTCATCGAACAGCTACTCGCCACCGTCGTCCGCCGCGGCGTCTTCTACACCATCTGCAAT
CGCGATGGCGGTTGGACCCAGCCCCTTGTTGTCCTATACTATGTGAGTAAAACCAATCCTCTGGCCCCCTCCCCT
TGGCGCGACCTCGCGTAGGCTGACGGCTGGGCGCAGCTCAATTACCTCACCAAATATCTCGAGCTGCTCGACACC
GTCTTCCTCTTTCTCAAGAAGAAGCCTTTGAGTACGTTGCTCTCCTTTTTTCTGCGCCCGACTCGACTGGTAGAC
GCTAATGCGCATCGCAGCCTTCCTGCATTGCTACCATCATGGCGCCACCGCCCTCCTTTGCTACACGCAGCTTGT
CGGCTCCACGGCCGTTTCATGGGTCCCCATCACGCTCAACTTGACGGTGCACGTCGTCATGTACTGGTACTACTT
CCAGAGTGCGCGCGGTGTCCGCGTGTGGTGGAAGGAGTGGGTGACGCGCCTCCAGATTGTCCAGTTCATCATCGA
TCTATGTAAGTCGCCTCTTGGATGGCTTCACCTCCCCGGCTAACCTCTGCTCGCCCAGTCTTCGTCTACTTTGCC
TCTTACACGTACTTTACGTCGACGTATTTCCCGTCCCTGCCCAACCAAGGCACGTGCGCGGGAGAGGAGTTTGCG
GCTTTCTGCGGCATTGCCATCTTGAGCTCTTACCTAGTGCTCTTCATCTCCTTCTACTTTGCCACGTACAAGAAG
TGCGGCAAGGCGACGACGAGCTGCAAGTCGCTCCGTCGCATGAGCCAAGCGCCGCTCCCCGACCCGCTGCATCTG
CAAGCGGCCATGAACGGCATCAACGGCAACGCCAATGGCAACGGCAACGGCGTCCATGTGACGGGGTCCAAGTCC
AACGGCACCACGCCCAACGGCACCCGTTCTCGCAAAGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail