Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6482
Gene name
Locationscaffold_57:9588..10625
Strand+
Gene length (bp)1037
Transcript length (bp)981
Coding sequence length (bp)978
Protein length (aa) 326

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9US27|LOA1_SCHPO Putative lysophosphatidic acid:oleoyl-CoA acyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps66 PE=3 SV=2 1 320 3.0E-09
sp|Q06508|LOA1_YEAST Lysophosphatidic acid:oleoyl-CoA acyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LOA1 PE=1 SV=1 1 197 7.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 40 59 19
3 66 83 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6482
MEKYSQFRDKSTGIAPFLPISTPLSVVSTLTHGLIFLCRLPIFLGYAFCYFFLFHYLPLPVVARKVALWGLMAIP
GIWWVDIQLDGVRRGTLSEQPRERVPHAGSVIAATFTSPIDAVYLAAVFDPIFTISYPGDRRLRRVGLLGAVAAA
LAPVRTAPPADDALVDINELLEQFPDRVIAVFPECGTTNGKAILPLSPALAQCRPDVHVFPVSIRYALPDVTTPV
PGQWPTFFWNLLSRPTTCIRIRIAEGRRKDMTNGINGSPVTPASPGQLRRRLDSGSSLSDEEKRLLDRLAEALAR
LSRVKRVGLTMNDKAAFVAAWRGTKT
Coding >Ophio5|6482
ATGGAGAAATACAGCCAATTCCGCGATAAATCCACGGGCATCGCGCCCTTCCTCCCCATCTCGACGCCCCTATCT
GTCGTGTCGACGCTGACGCACGGCCTCATCTTCCTATGCCGGCTCCCCATCTTCCTCGGCTACGCCTTCTGCTAC
TTCTTTCTTTTCCACTACCTGCCGCTGCCCGTCGTCGCCCGAAAGGTGGCCCTTTGGGGACTCATGGCCATCCCC
GGAATCTGGTGGGTTGATATTCAGCTTGATGGCGTTCGAAGGGGTACCTTGTCGGAGCAGCCGCGCGAGCGCGTG
CCTCATGCCGGCTCCGTCATCGCCGCCACCTTCACCAGCCCCATCGACGCCGTCTATCTCGCCGCCGTCTTCGAC
CCCATCTTCACCATCTCCTATCCAGGCGACCGCAGGTTGCGCCGAGTCGGTCTGCTGGGCGCCGTCGCCGCCGCT
CTCGCTCCCGTTCGCACTGCGCCTCCCGCTGACGACGCCCTCGTCGACATCAACGAACTGCTCGAACAGTTTCCC
GACCGCGTCATCGCCGTCTTCCCCGAGTGCGGCACCACAAACGGCAAGGCTATCCTGCCACTGAGTCCTGCCCTC
GCTCAGTGCCGGCCCGACGTCCACGTCTTCCCCGTCAGCATCCGCTACGCCCTCCCCGACGTCACCACCCCGGTG
CCCGGCCAGTGGCCCACCTTCTTCTGGAACCTGCTCTCCCGCCCGACCACCTGCATCCGCATCCGCATCGCCGAG
GGCCGCCGGAAGGACATGACCAACGGCATCAACGGCTCCCCCGTGACCCCTGCTTCCCCTGGGCAACTGAGAAGG
CGCCTCGACTCGGGCTCCAGCCTCTCCGATGAGGAGAAGAGGCTCTTGGATCGCCTAGCCGAAGCACTTGCCCGT
CTCAGCAGGGTAAAGCGCGTCGGCTTGACCATGAATGACAAGGCCGCCTTTGTCGCCGCCTGGCGCGGGACCAAG
ACC
Transcript >Ophio5|6482
ATGGAGAAATACAGCCAATTCCGCGATAAATCCACGGGCATCGCGCCCTTCCTCCCCATCTCGACGCCCCTATCT
GTCGTGTCGACGCTGACGCACGGCCTCATCTTCCTATGCCGGCTCCCCATCTTCCTCGGCTACGCCTTCTGCTAC
TTCTTTCTTTTCCACTACCTGCCGCTGCCCGTCGTCGCCCGAAAGGTGGCCCTTTGGGGACTCATGGCCATCCCC
GGAATCTGGTGGGTTGATATTCAGCTTGATGGCGTTCGAAGGGGTACCTTGTCGGAGCAGCCGCGCGAGCGCGTG
CCTCATGCCGGCTCCGTCATCGCCGCCACCTTCACCAGCCCCATCGACGCCGTCTATCTCGCCGCCGTCTTCGAC
CCCATCTTCACCATCTCCTATCCAGGCGACCGCAGGTTGCGCCGAGTCGGTCTGCTGGGCGCCGTCGCCGCCGCT
CTCGCTCCCGTTCGCACTGCGCCTCCCGCTGACGACGCCCTCGTCGACATCAACGAACTGCTCGAACAGTTTCCC
GACCGCGTCATCGCCGTCTTCCCCGAGTGCGGCACCACAAACGGCAAGGCTATCCTGCCACTGAGTCCTGCCCTC
GCTCAGTGCCGGCCCGACGTCCACGTCTTCCCCGTCAGCATCCGCTACGCCCTCCCCGACGTCACCACCCCGGTG
CCCGGCCAGTGGCCCACCTTCTTCTGGAACCTGCTCTCCCGCCCGACCACCTGCATCCGCATCCGCATCGCCGAG
GGCCGCCGGAAGGACATGACCAACGGCATCAACGGCTCCCCCGTGACCCCTGCTTCCCCTGGGCAACTGAGAAGG
CGCCTCGACTCGGGCTCCAGCCTCTCCGATGAGGAGAAGAGGCTCTTGGATCGCCTAGCCGAAGCACTTGCCCGT
CTCAGCAGGGTAAAGCGCGTCGGCTTGACCATGAATGACAAGGCCGCCTTTGTCGCCGCCTGGCGCGGGACCAAG
ACCTGA
Gene >Ophio5|6482
ATGGAGAAATACAGCCAATTCCGCGATAAATGTTCCAAGCCCGCCCCCCTCCTTCTCCTCTCCCCATCGCTGACG
TCTTTCTTCAAGCCACGGGCATCGCGCCCTTCCTCCCCATCTCGACGCCCCTATCTGTCGTGTCGACGCTGACGC
ACGGCCTCATCTTCCTATGCCGGCTCCCCATCTTCCTCGGCTACGCCTTCTGCTACTTCTTTCTTTTCCACTACC
TGCCGCTGCCCGTCGTCGCCCGAAAGGTGGCCCTTTGGGGACTCATGGCCATCCCCGGAATCTGGTGGGTTGATA
TTCAGCTTGATGGCGTTCGAAGGGGTACCTTGTCGGAGCAGCCGCGCGAGCGCGTGCCTCATGCCGGCTCCGTCA
TCGCCGCCACCTTCACCAGCCCCATCGACGCCGTCTATCTCGCCGCCGTCTTCGACCCCATCTTCACCATCTCCT
ATCCAGGCGACCGCAGGTTGCGCCGAGTCGGTCTGCTGGGCGCCGTCGCCGCCGCTCTCGCTCCCGTTCGCACTG
CGCCTCCCGCTGACGACGCCCTCGTCGACATCAACGAACTGCTCGAACAGTTTCCCGACCGCGTCATCGCCGTCT
TCCCCGAGTGCGGCACCACAAACGGCAAGGCTATCCTGCCACTGAGTCCTGCCCTCGCTCAGTGCCGGCCCGACG
TCCACGTCTTCCCCGTCAGCATCCGCTACGCCCTCCCCGACGTCACCACCCCGGTGCCCGGCCAGTGGCCCACCT
TCTTCTGGAACCTGCTCTCCCGCCCGACCACCTGCATCCGCATCCGCATCGCCGAGGGCCGCCGGAAGGACATGA
CCAACGGCATCAACGGCTCCCCCGTGACCCCTGCTTCCCCTGGGCAACTGAGAAGGCGCCTCGACTCGGGCTCCA
GCCTCTCCGATGAGGAGAAGAGGCTCTTGGATCGCCTAGCCGAAGCACTTGCCCGTCTCAGCAGGGTAAAGCGCG
TCGGCTTGACCATGAATGACAAGGCCGCCTTTGTCGCCGCCTGGCGCGGGACCAAGACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail