Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6481
Gene name
Locationscaffold_57:3187..4318
Strand+
Gene length (bp)1131
Transcript length (bp)1131
Coding sequence length (bp)1128
Protein length (aa) 376

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein 1.4E-08 153 299

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|F4JCQ3|DG783_ARATH Putative DNA glycosylase At3g47830 OS=Arabidopsis thaliana GN=At3g47830 PE=3 SV=1 100 322 2.0E-40
sp|Q9WYK0|END3_THEMA Endonuclease III OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=nth PE=3 SV=1 151 321 2.0E-16
sp|Q9SR66|DML2_ARATH DEMETER-like protein 2 OS=Arabidopsis thaliana GN=DML2 PE=3 SV=2 164 316 5.0E-13
sp|Q8LK56|DME_ARATH Transcriptional activator DEMETER OS=Arabidopsis thaliana GN=DME PE=1 SV=2 168 338 1.0E-11
sp|Q9SJQ6|ROS1_ARATH Protein ROS1 OS=Arabidopsis thaliana GN=ROS1 PE=1 SV=2 168 342 1.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|F4JCQ3|DG783_ARATH Putative DNA glycosylase At3g47830 OS=Arabidopsis thaliana GN=At3g47830 PE=3 SV=1 100 322 2.0E-40
sp|Q9WYK0|END3_THEMA Endonuclease III OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=nth PE=3 SV=1 151 321 2.0E-16
sp|Q9SR66|DML2_ARATH DEMETER-like protein 2 OS=Arabidopsis thaliana GN=DML2 PE=3 SV=2 164 316 5.0E-13
sp|Q8LK56|DME_ARATH Transcriptional activator DEMETER OS=Arabidopsis thaliana GN=DME PE=1 SV=2 168 338 1.0E-11
sp|Q9SJQ6|ROS1_ARATH Protein ROS1 OS=Arabidopsis thaliana GN=ROS1 PE=1 SV=2 168 342 1.0E-11
sp|O49498|DML3_ARATH DEMETER-like protein 3 OS=Arabidopsis thaliana GN=DML3 PE=2 SV=2 164 355 2.0E-10
sp|Q58829|Y1434_METJA Putative endonuclease MJ1434 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1434 PE=3 SV=1 150 322 3.0E-09
sp|P54137|NTH_CAEEL Endonuclease III homolog OS=Caenorhabditis elegans GN=nth-1 PE=1 SV=2 133 370 4.0E-08
sp|Q92GH4|END3_RICCN Endonuclease III OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=nth PE=3 SV=1 152 322 4.0E-08
sp|P0AB84|END3_ECOL6 Endonuclease III OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nth PE=3 SV=1 144 321 4.0E-08
sp|P0AB83|END3_ECOLI Endonuclease III OS=Escherichia coli (strain K12) GN=nth PE=1 SV=1 144 321 4.0E-08
sp|O05956|END3_RICPR Endonuclease III OS=Rickettsia prowazekii (strain Madrid E) GN=nth PE=3 SV=1 149 328 2.0E-07
sp|Q89AW4|END3_BUCBP Endonuclease III OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=nth PE=3 SV=1 146 321 2.0E-07
sp|Q4UK93|END3_RICFE Endonuclease III OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=nth PE=3 SV=1 152 322 3.0E-07
sp|Q9SIC4|NTH1_ARATH Endonuclease III homolog 1, chloroplastic OS=Arabidopsis thaliana GN=NTH1 PE=2 SV=2 135 321 5.0E-07
sp|O83754|END3_TREPA Endonuclease III OS=Treponema pallidum (strain Nichols) GN=nth PE=3 SV=1 116 321 8.0E-07
sp|P73715|END3_SYNY3 Endonuclease III OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nth PE=3 SV=1 152 333 2.0E-06
sp|B9DFZ0|NTH2_ARATH Endonuclease III homolog 2, chloroplastic OS=Arabidopsis thaliana GN=NTH2 PE=2 SV=1 231 316 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006284 base-excision repair Yes
GO:0044260 cellular macromolecule metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0050896 response to stimulus No
GO:0006259 DNA metabolic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0033554 cellular response to stress No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:1901360 organic cyclic compound metabolic process No
GO:0051716 cellular response to stimulus No
GO:0006807 nitrogen compound metabolic process No
GO:0006281 DNA repair No
GO:0006974 cellular response to DNA damage stimulus No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006950 response to stress No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1385 0.9513 0.0805 0.0173 0.1842 0.0888 0.0267 0.005 0.0169 0.0031

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2454
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|540
Ophiocordyceps australis map64 (Brazil) OphauB2|6235
Ophiocordyceps camponoti-floridani Ophcf2|03055
Ophiocordyceps camponoti-rufipedis Ophun1|5080
Ophiocordyceps kimflemingae Ophio5|6481 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3525

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6481
MAVSAAESPPLRRSARKAKRPVDVVAQASLTSPAPKKRIKTESPPLPWPEEKKSVPATSPSPKKRRTKTKEPSPS
PDGIDKATHLRDRKLKAFAAHSRQSPFPDWAHPTPAECALAHDILAQLHGDRVRPERVVAPAATAGCGNSPSVLD
ALVRTILSQNTSDRNSSRAKRDMDAVYGGSDHWDAIAEGGQEKLQRAIQSGGLSVVKSRVIIQVLQQAKARYGVY
SLDHLFDASDDDAMREMLSFQGVGPKTASCVLLFCLRRASFAVDTHVYRITGLLGWRPPKASREDTQAHLDALIP
AEEKYPLHILLINHGKRCAECRAGGKSLGRCELRKAFRQGRLEGKAGEDIKEEEMEAVKQEEALNEVKEEASSPD
S
Coding >Ophio5|6481
ATGGCCGTCTCCGCCGCCGAGTCCCCCCCTCTCAGGCGCAGTGCCCGAAAGGCGAAGCGGCCAGTCGACGTCGTC
GCCCAAGCCTCGCTCACCTCTCCAGCGCCCAAGAAGCGCATCAAGACGGAGTCGCCGCCTCTTCCTTGGCCCGAA
GAAAAAAAAAGCGTGCCTGCCACCTCTCCATCTCCGAAGAAGCGGCGCACCAAGACGAAGGAGCCGTCACCATCG
CCAGATGGCATCGACAAAGCAACCCATCTCCGAGATCGCAAGCTTAAAGCCTTCGCAGCCCACTCCCGACAGTCT
CCCTTCCCAGACTGGGCCCATCCGACGCCAGCAGAGTGCGCGCTGGCCCATGATATCCTCGCACAGCTGCATGGC
GACCGTGTCCGGCCGGAGCGGGTGGTTGCGCCCGCGGCGACGGCCGGCTGCGGCAACTCGCCGTCTGTTCTCGAC
GCCCTCGTCCGTACCATCCTATCGCAGAACACGAGCGACCGCAACAGCTCCCGCGCAAAGCGGGACATGGACGCC
GTCTACGGCGGCAGCGACCACTGGGACGCCATCGCCGAGGGCGGCCAGGAAAAGTTGCAGCGCGCCATTCAGTCG
GGCGGCCTCAGCGTCGTCAAGTCGCGCGTCATCATCCAGGTGCTGCAGCAGGCCAAGGCCCGCTATGGCGTCTAT
TCGCTCGACCATCTCTTTGACGCGTCTGACGACGACGCCATGCGCGAGATGCTCTCCTTCCAGGGCGTCGGTCCC
AAGACGGCCAGCTGCGTTCTTCTCTTTTGCCTGCGGCGTGCCAGCTTCGCTGTCGATACCCACGTATATCGCATC
ACGGGCCTGCTCGGCTGGCGGCCTCCCAAGGCGTCGCGCGAGGATACCCAGGCGCACCTCGACGCTCTCATCCCG
GCCGAGGAGAAATACCCGCTGCACATCCTGCTCATCAATCACGGGAAGCGCTGTGCCGAGTGTCGCGCCGGCGGC
AAGAGTCTGGGCCGATGTGAGTTGAGGAAGGCCTTTCGACAGGGCCGTCTCGAGGGCAAGGCAGGCGAGGATATC
AAGGAGGAGGAGATGGAAGCGGTGAAGCAAGAGGAGGCTCTGAATGAGGTAAAAGAGGAGGCTTCTTCGCCGGAT
AGT
Transcript >Ophio5|6481
ATGGCCGTCTCCGCCGCCGAGTCCCCCCCTCTCAGGCGCAGTGCCCGAAAGGCGAAGCGGCCAGTCGACGTCGTC
GCCCAAGCCTCGCTCACCTCTCCAGCGCCCAAGAAGCGCATCAAGACGGAGTCGCCGCCTCTTCCTTGGCCCGAA
GAAAAAAAAAGCGTGCCTGCCACCTCTCCATCTCCGAAGAAGCGGCGCACCAAGACGAAGGAGCCGTCACCATCG
CCAGATGGCATCGACAAAGCAACCCATCTCCGAGATCGCAAGCTTAAAGCCTTCGCAGCCCACTCCCGACAGTCT
CCCTTCCCAGACTGGGCCCATCCGACGCCAGCAGAGTGCGCGCTGGCCCATGATATCCTCGCACAGCTGCATGGC
GACCGTGTCCGGCCGGAGCGGGTGGTTGCGCCCGCGGCGACGGCCGGCTGCGGCAACTCGCCGTCTGTTCTCGAC
GCCCTCGTCCGTACCATCCTATCGCAGAACACGAGCGACCGCAACAGCTCCCGCGCAAAGCGGGACATGGACGCC
GTCTACGGCGGCAGCGACCACTGGGACGCCATCGCCGAGGGCGGCCAGGAAAAGTTGCAGCGCGCCATTCAGTCG
GGCGGCCTCAGCGTCGTCAAGTCGCGCGTCATCATCCAGGTGCTGCAGCAGGCCAAGGCCCGCTATGGCGTCTAT
TCGCTCGACCATCTCTTTGACGCGTCTGACGACGACGCCATGCGCGAGATGCTCTCCTTCCAGGGCGTCGGTCCC
AAGACGGCCAGCTGCGTTCTTCTCTTTTGCCTGCGGCGTGCCAGCTTCGCTGTCGATACCCACGTATATCGCATC
ACGGGCCTGCTCGGCTGGCGGCCTCCCAAGGCGTCGCGCGAGGATACCCAGGCGCACCTCGACGCTCTCATCCCG
GCCGAGGAGAAATACCCGCTGCACATCCTGCTCATCAATCACGGGAAGCGCTGTGCCGAGTGTCGCGCCGGCGGC
AAGAGTCTGGGCCGATGTGAGTTGAGGAAGGCCTTTCGACAGGGCCGTCTCGAGGGCAAGGCAGGCGAGGATATC
AAGGAGGAGGAGATGGAAGCGGTGAAGCAAGAGGAGGCTCTGAATGAGGTAAAAGAGGAGGCTTCTTCGCCGGAT
AGTTGA
Gene >Ophio5|6481
ATGGCCGTCTCCGCCGCCGAGTCCCCCCCTCTCAGGCGCAGTGCCCGAAAGGCGAAGCGGCCAGTCGACGTCGTC
GCCCAAGCCTCGCTCACCTCTCCAGCGCCCAAGAAGCGCATCAAGACGGAGTCGCCGCCTCTTCCTTGGCCCGAA
GAAAAAAAAAGCGTGCCTGCCACCTCTCCATCTCCGAAGAAGCGGCGCACCAAGACGAAGGAGCCGTCACCATCG
CCAGATGGCATCGACAAAGCAACCCATCTCCGAGATCGCAAGCTTAAAGCCTTCGCAGCCCACTCCCGACAGTCT
CCCTTCCCAGACTGGGCCCATCCGACGCCAGCAGAGTGCGCGCTGGCCCATGATATCCTCGCACAGCTGCATGGC
GACCGTGTCCGGCCGGAGCGGGTGGTTGCGCCCGCGGCGACGGCCGGCTGCGGCAACTCGCCGTCTGTTCTCGAC
GCCCTCGTCCGTACCATCCTATCGCAGAACACGAGCGACCGCAACAGCTCCCGCGCAAAGCGGGACATGGACGCC
GTCTACGGCGGCAGCGACCACTGGGACGCCATCGCCGAGGGCGGCCAGGAAAAGTTGCAGCGCGCCATTCAGTCG
GGCGGCCTCAGCGTCGTCAAGTCGCGCGTCATCATCCAGGTGCTGCAGCAGGCCAAGGCCCGCTATGGCGTCTAT
TCGCTCGACCATCTCTTTGACGCGTCTGACGACGACGCCATGCGCGAGATGCTCTCCTTCCAGGGCGTCGGTCCC
AAGACGGCCAGCTGCGTTCTTCTCTTTTGCCTGCGGCGTGCCAGCTTCGCTGTCGATACCCACGTATATCGCATC
ACGGGCCTGCTCGGCTGGCGGCCTCCCAAGGCGTCGCGCGAGGATACCCAGGCGCACCTCGACGCTCTCATCCCG
GCCGAGGAGAAATACCCGCTGCACATCCTGCTCATCAATCACGGGAAGCGCTGTGCCGAGTGTCGCGCCGGCGGC
AAGAGTCTGGGCCGATGTGAGTTGAGGAAGGCCTTTCGACAGGGCCGTCTCGAGGGCAAGGCAGGCGAGGATATC
AAGGAGGAGGAGATGGAAGCGGTGAAGCAAGAGGAGGCTCTGAATGAGGTAAAAGAGGAGGCTTCTTCGCCGGAT
AGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail