Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6477
Gene name
Locationscaffold_569:6312..8134
Strand-
Gene length (bp)1822
Transcript length (bp)1716
Coding sequence length (bp)1713
Protein length (aa) 571

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane Signal peptide|Transmembrane domain 0.1416 0.0806 0.149 0.7589 0.0859 0.0093 0.2129 0.5346 0.3558 0.0029

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 45 67 22
2 95 117 22
3 132 154 22
4 167 189 22
5 209 231 22
6 250 272 22
7 287 309 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3198
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6329
Ophiocordyceps australis map64 (Brazil) OphauB2|5817
Ophiocordyceps camponoti-floridani Ophcf2|04865
Ophiocordyceps camponoti-rufipedis Ophun1|4278
Ophiocordyceps kimflemingae Ophio5|6477 (this protein)
Ophiocordyceps subramaniannii Hirsu2|5745

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6477
MDGAGLWARANDNQLGLSADVVSRMSATAPVDDKTRLKAETSLRTAFVVLAVINALGGAATALGIYIDCRLRARR
KSEPSPRRSPLSVIGTKEMVPFVVSVGIVAQGALFAAAQTSGLDSVLTLGCRPVSQMMLPALFIVPFTQTAFGIE
AMIRSLPRKPMANGPAWTLPVCVGLVLAGLMVSYGVTLVSEPANFCFAELLFLLQRWSVGVFAVLVSIACLLLLC
SIILLFRLYRTADMARPQRTAASWTACYMLLAVITILMTLPFFATLMEDDGVSDITREMMQLSTAATIVVNMTGL
LTGALYLVLRLTRLGRLGYTGYVEYDRQRLKSGIRTVRASSVMYNKQLEQPVSPEWLERREYGTSAQAIPDEKTA
TQWPIQKQAAPRKAGGPSYNLFPQSNPPATVAAAAAGADAAAFLLPPTATWTARHERNSSFGSSATVPIALRVSN
IDNMAVQMMSNSIQQPLQPPSNLGLAISTDGGPFSDSNAAYVASKNVDVFDDGEAEAPTPPPLTVTRATPDASDA
FTLSPSVYSPKTTSTASPEQAPLRTPPASRQRGGEAGRAVASGQWI
Coding >Ophio5|6477
ATGGACGGAGCCGGCCTGTGGGCGAGAGCCAATGACAACCAGCTTGGTTTGTCGGCCGATGTCGTCTCGCGGATG
AGCGCGACGGCGCCCGTCGACGACAAGACGCGGCTCAAGGCCGAGACGTCGCTGCGTACGGCCTTTGTCGTTCTC
GCCGTCATCAATGCCCTGGGTGGAGCGGCGACGGCGCTGGGCATCTATATCGATTGCCGTCTCAGGGCGAGGAGA
AAGTCTGAACCGTCACCCAGAAGGTCACCTCTCAGTGTCATCGGCACCAAGGAGATGGTTCCCTTTGTCGTTTCG
GTCGGCATCGTCGCCCAGGGCGCTCTGTTCGCGGCGGCGCAGACCAGCGGACTGGACTCGGTCCTGACGCTCGGC
TGCCGGCCCGTCTCGCAGATGATGCTGCCAGCCCTCTTCATCGTGCCCTTCACCCAGACGGCTTTTGGCATCGAG
GCCATGATACGATCACTGCCACGAAAGCCAATGGCCAACGGTCCGGCCTGGACGCTGCCCGTCTGTGTCGGCCTG
GTTCTGGCCGGGCTGATGGTCAGCTACGGCGTCACGCTGGTGTCGGAGCCGGCAAACTTTTGCTTCGCCGAGCTG
CTGTTCCTGTTGCAGCGGTGGAGCGTGGGCGTCTTTGCCGTGCTCGTCTCCATTGCCTGCTTGTTACTCCTCTGC
AGCATCATCCTCCTGTTCCGGCTATACCGGACAGCGGACATGGCGCGGCCGCAGCGGACGGCGGCATCGTGGACG
GCCTGCTATATGCTCCTGGCCGTCATCACCATCCTCATGACGTTACCCTTTTTCGCGACGCTGATGGAGGACGAC
GGCGTGTCGGACATCACGCGCGAGATGATGCAGCTTTCGACGGCGGCCACCATCGTCGTCAACATGACGGGCCTC
CTCACCGGCGCCCTCTACCTTGTGCTACGTCTGACGCGGCTCGGCAGGCTGGGCTACACCGGCTACGTCGAGTAT
GACCGGCAGAGGCTCAAGTCGGGCATCCGGACGGTGCGGGCCAGCAGCGTCATGTATAACAAGCAGCTGGAGCAG
CCCGTGTCGCCCGAGTGGCTCGAGCGTCGCGAATATGGGACCAGCGCCCAGGCCATACCGGACGAGAAGACGGCG
ACGCAATGGCCGATACAGAAGCAGGCGGCCCCTCGCAAGGCCGGCGGCCCCTCGTACAACCTCTTCCCTCAATCC
AATCCTCCGGCGACGGTTGCGGCTGCGGCGGCGGGAGCGGACGCTGCCGCGTTCCTGCTCCCTCCTACGGCGACG
TGGACGGCTCGCCATGAGAGAAATTCTTCTTTTGGCTCCTCGGCCACGGTCCCGATCGCTCTGCGCGTCTCCAAT
ATCGACAACATGGCGGTGCAAATGATGAGCAACTCCATTCAACAACCTCTACAACCACCAAGCAACCTCGGACTC
GCCATCAGCACAGATGGCGGGCCCTTTTCCGACTCGAACGCCGCGTACGTGGCGTCGAAAAACGTCGACGTCTTT
GACGACGGAGAGGCGGAGGCTCCCACGCCGCCGCCCCTGACCGTCACCAGGGCCACGCCCGACGCTAGCGACGCC
TTTACTCTCAGCCCTAGCGTCTACAGCCCTAAGACGACGTCGACGGCGTCGCCAGAGCAGGCCCCGCTCCGGACG
CCGCCGGCTAGCCGTCAGCGCGGAGGAGAGGCGGGCCGGGCGGTGGCTTCGGGACAGTGGATC
Transcript >Ophio5|6477
ATGGACGGAGCCGGCCTGTGGGCGAGAGCCAATGACAACCAGCTTGGTTTGTCGGCCGATGTCGTCTCGCGGATG
AGCGCGACGGCGCCCGTCGACGACAAGACGCGGCTCAAGGCCGAGACGTCGCTGCGTACGGCCTTTGTCGTTCTC
GCCGTCATCAATGCCCTGGGTGGAGCGGCGACGGCGCTGGGCATCTATATCGATTGCCGTCTCAGGGCGAGGAGA
AAGTCTGAACCGTCACCCAGAAGGTCACCTCTCAGTGTCATCGGCACCAAGGAGATGGTTCCCTTTGTCGTTTCG
GTCGGCATCGTCGCCCAGGGCGCTCTGTTCGCGGCGGCGCAGACCAGCGGACTGGACTCGGTCCTGACGCTCGGC
TGCCGGCCCGTCTCGCAGATGATGCTGCCAGCCCTCTTCATCGTGCCCTTCACCCAGACGGCTTTTGGCATCGAG
GCCATGATACGATCACTGCCACGAAAGCCAATGGCCAACGGTCCGGCCTGGACGCTGCCCGTCTGTGTCGGCCTG
GTTCTGGCCGGGCTGATGGTCAGCTACGGCGTCACGCTGGTGTCGGAGCCGGCAAACTTTTGCTTCGCCGAGCTG
CTGTTCCTGTTGCAGCGGTGGAGCGTGGGCGTCTTTGCCGTGCTCGTCTCCATTGCCTGCTTGTTACTCCTCTGC
AGCATCATCCTCCTGTTCCGGCTATACCGGACAGCGGACATGGCGCGGCCGCAGCGGACGGCGGCATCGTGGACG
GCCTGCTATATGCTCCTGGCCGTCATCACCATCCTCATGACGTTACCCTTTTTCGCGACGCTGATGGAGGACGAC
GGCGTGTCGGACATCACGCGCGAGATGATGCAGCTTTCGACGGCGGCCACCATCGTCGTCAACATGACGGGCCTC
CTCACCGGCGCCCTCTACCTTGTGCTACGTCTGACGCGGCTCGGCAGGCTGGGCTACACCGGCTACGTCGAGTAT
GACCGGCAGAGGCTCAAGTCGGGCATCCGGACGGTGCGGGCCAGCAGCGTCATGTATAACAAGCAGCTGGAGCAG
CCCGTGTCGCCCGAGTGGCTCGAGCGTCGCGAATATGGGACCAGCGCCCAGGCCATACCGGACGAGAAGACGGCG
ACGCAATGGCCGATACAGAAGCAGGCGGCCCCTCGCAAGGCCGGCGGCCCCTCGTACAACCTCTTCCCTCAATCC
AATCCTCCGGCGACGGTTGCGGCTGCGGCGGCGGGAGCGGACGCTGCCGCGTTCCTGCTCCCTCCTACGGCGACG
TGGACGGCTCGCCATGAGAGAAATTCTTCTTTTGGCTCCTCGGCCACGGTCCCGATCGCTCTGCGCGTCTCCAAT
ATCGACAACATGGCGGTGCAAATGATGAGCAACTCCATTCAACAACCTCTACAACCACCAAGCAACCTCGGACTC
GCCATCAGCACAGATGGCGGGCCCTTTTCCGACTCGAACGCCGCGTACGTGGCGTCGAAAAACGTCGACGTCTTT
GACGACGGAGAGGCGGAGGCTCCCACGCCGCCGCCCCTGACCGTCACCAGGGCCACGCCCGACGCTAGCGACGCC
TTTACTCTCAGCCCTAGCGTCTACAGCCCTAAGACGACGTCGACGGCGTCGCCAGAGCAGGCCCCGCTCCGGACG
CCGCCGGCTAGCCGTCAGCGCGGAGGAGAGGCGGGCCGGGCGGTGGCTTCGGGACAGTGGATCTGA
Gene >Ophio5|6477
ATGGACGGAGCCGGCCTGTGGGCGAGAGCCAATGACAACCAGCTTGGTTTGTCGGCCGATGTCGTCTCGCGGATG
AGCGCGACGGCGCCCGTCGACGACAAGACGCGGCTCAAGGCCGAGACGTCGCTGCGTACGGCCTTTGTCGTTCTC
GCCGTCATCAATGCCCTGGGTGGAGCGGCGACGGCGCTGGGCATCTATATCGATTGCCGTCTCAGGGCGAGGAGA
AAGTCTGAACCGTCACCCAGGTAGGGCGCGAAGCTTCACAAGTTCGGGGCAGGGGACTGACAATACCGCAGAAGG
TCACCTCTCAGTGTCATCGGCACCAAGGAGATGGTTCCCTTTGTCGTTTCGGTCGGCATCGTCGCCCAGGGCGCT
CTGTTCGCGGCGGCGCAGACCAGCGGACTGGACTCGGTCCTGACGCTCGGCTGCCGGCCCGTCTCGCAGATGATG
CTGCCAGGTAAGGACGTGTGCAAGTCGGCAGTATTGAAAACATGACGCTGACGGAGCAGCAGCCCTCTTCATCGT
GCCCTTCACCCAGACGGCTTTTGGCATCGAGGCCATGATACGATCACTGCCACGAAAGCCAATGGCCAACGGTCC
GGCCTGGACGCTGCCCGTCTGTGTCGGCCTGGTTCTGGCCGGGCTGATGGTCAGCTACGGCGTCACGCTGGTGTC
GGAGCCGGCAAACTTTTGCTTCGCCGAGCTGCTGTTCCTGTTGCAGCGGTGGAGCGTGGGCGTCTTTGCCGTGCT
CGTCTCCATTGCCTGCTTGTTACTCCTCTGCAGCATCATCCTCCTGTTCCGGCTATACCGGACAGCGGACATGGC
GCGGCCGCAGCGGACGGCGGCATCGTGGACGGCCTGCTATATGCTCCTGGCCGTCATCACCATCCTCATGACGTT
ACCCTTTTTCGCGACGCTGATGGAGGACGACGGCGTGTCGGACATCACGCGCGAGATGATGCAGCTTTCGACGGC
GGCCACCATCGTCGTCAACATGACGGGCCTCCTCACCGGCGCCCTCTACCTTGTGCTACGTCTGACGCGGCTCGG
CAGGCTGGGCTACACCGGCTACGTCGAGTATGACCGGCAGAGGCTCAAGTCGGGCATCCGGACGGTGCGGGCCAG
CAGCGTCATGTATAACAAGCAGCTGGAGCAGCCCGTGTCGCCCGAGTGGCTCGAGCGTCGCGAATATGGGACCAG
CGCCCAGGCCATACCGGACGAGAAGACGGCGACGCAATGGCCGATACAGAAGCAGGCGGCCCCTCGCAAGGCCGG
CGGCCCCTCGTACAACCTCTTCCCTCAATCCAATCCTCCGGCGACGGTTGCGGCTGCGGCGGCGGGAGCGGACGC
TGCCGCGTTCCTGCTCCCTCCTACGGCGACGTGGACGGCTCGCCATGAGAGAAATTCTTCTTTTGGCTCCTCGGC
CACGGTCCCGATCGCTCTGCGCGTCTCCAATATCGACAACATGGCGGTGCAAATGATGAGCAACTCCATTCAACA
ACCTCTACAACCACCAAGCAACCTCGGACTCGCCATCAGCACAGATGGCGGGCCCTTTTCCGACTCGAACGCCGC
GTACGTGGCGTCGAAAAACGTCGACGTCTTTGACGACGGAGAGGCGGAGGCTCCCACGCCGCCGCCCCTGACCGT
CACCAGGGCCACGCCCGACGCTAGCGACGCCTTTACTCTCAGCCCTAGCGTCTACAGCCCTAAGACGACGTCGAC
GGCGTCGCCAGAGCAGGCCCCGCTCCGGACGCCGCCGGCTAGCCGTCAGCGCGGAGGAGAGGCGGGCCGGGCGGT
GGCTTCGGGACAGTGGATCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail