Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6470
Gene name
Locationscaffold_568:5923..6974
Strand-
Gene length (bp)1051
Transcript length (bp)978
Coding sequence length (bp)975
Protein length (aa) 325

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04190 GET4 Golgi to ER traffic protein 4 1.1E-86 40 301

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12125|GET4_YEAST Golgi to ER traffic protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GET4 PE=1 SV=1 4 304 1.0E-47
sp|O74432|GET4_SCHPO Golgi to ER traffic protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=get4 PE=3 SV=1 1 313 3.0E-47
sp|Q54TH4|GET4_DICDI Golgi to ER traffic protein 4 homolog OS=Dictyostelium discoideum GN=DDB_G0281815 PE=3 SV=1 6 300 1.0E-23
sp|Q7L5D6|GET4_HUMAN Golgi to ER traffic protein 4 homolog OS=Homo sapiens GN=GET4 PE=1 SV=1 5 325 3.0E-20
sp|A1Z3X3|GET4_ORYLA Golgi to ER traffic protein 4 homolog OS=Oryzias latipes GN=get4 PE=2 SV=1 5 290 3.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12125|GET4_YEAST Golgi to ER traffic protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GET4 PE=1 SV=1 4 304 1.0E-47
sp|O74432|GET4_SCHPO Golgi to ER traffic protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=get4 PE=3 SV=1 1 313 3.0E-47
sp|Q54TH4|GET4_DICDI Golgi to ER traffic protein 4 homolog OS=Dictyostelium discoideum GN=DDB_G0281815 PE=3 SV=1 6 300 1.0E-23
sp|Q7L5D6|GET4_HUMAN Golgi to ER traffic protein 4 homolog OS=Homo sapiens GN=GET4 PE=1 SV=1 5 325 3.0E-20
sp|A1Z3X3|GET4_ORYLA Golgi to ER traffic protein 4 homolog OS=Oryzias latipes GN=get4 PE=2 SV=1 5 290 3.0E-20
sp|Q6GLK9|GET4B_XENLA Golgi to ER traffic protein 4 homolog B OS=Xenopus laevis GN=get4-b PE=2 SV=1 5 291 9.0E-20
sp|Q0P5I8|GET4_BOVIN Golgi to ER traffic protein 4 homolog OS=Bos taurus GN=GET4 PE=2 SV=1 5 325 1.0E-19
sp|A4QNE0|GET4_XENTR Golgi to ER traffic protein 4 homolog OS=Xenopus tropicalis GN=get4 PE=2 SV=1 5 291 1.0E-19
sp|A0MT11|GET4_SALSA Golgi to ER traffic protein 4 homolog OS=Salmo salar GN=get4 PE=2 SV=1 5 291 2.0E-19
sp|A4GWN3|GET4_TAKRU Golgi to ER traffic protein 4 homolog OS=Takifugu rubripes GN=get4 PE=2 SV=1 5 290 9.0E-19
sp|Q9D1H7|GET4_MOUSE Golgi to ER traffic protein 4 homolog OS=Mus musculus GN=Get4 PE=1 SV=2 5 291 2.0E-18
sp|Q6NRL4|GET4A_XENLA Golgi to ER traffic protein 4 homolog A OS=Xenopus laevis GN=get4-a PE=2 SV=1 5 291 3.0E-18
sp|B5KFI0|GET4_TAEGU Golgi to ER traffic protein 4 homolog OS=Taeniopygia guttata GN=GET4 PE=2 SV=1 5 291 2.0E-17
sp|Q5ZKG8|GET4_CHICK Golgi to ER traffic protein 4 homolog OS=Gallus gallus GN=GET4 PE=2 SV=1 5 291 5.0E-15
sp|Q9VN19|GET4_DROME Golgi to ER traffic protein 4 homolog OS=Drosophila melanogaster GN=CG9853 PE=2 SV=1 5 302 9.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0045048 protein insertion into ER membrane Yes
GO:0045184 establishment of protein localization No
GO:0090150 establishment of protein localization to membrane No
GO:0051641 cellular localization No
GO:0051668 localization within membrane No
GO:0072657 protein localization to membrane No
GO:0009987 cellular process No
GO:0051205 protein insertion into membrane No
GO:0033036 macromolecule localization No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0070727 cellular macromolecule localization No
GO:0051179 localization No
GO:0008104 protein localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6470
MANRVDRIVARLQQKIVDGDFYEAQQQTRVAASRHIKTRNWPAAIDILASVAQALLRAGQGGSGGDLCVMLVDVY
VQAQLRPDAEAKGRLLTCLRLFDAAEPTRKRFISDMVSWSAKFGDYPAGDPELHHVAGSIYADEHEPYEAEKHLI
LGTKDSPEVLAKMEYEWYKEGDAHLAPHFAARAILGYLLVGNLRAANASHRVFTSALSSGNSGLNVQDVASAESD
LRVFPSLPLLNFLGLLLLAVPRGAPQVYRGLVTKYAAQINDVETWAESLELVAELYFGISRPRQSNPLMDMMSGL
FGGGGGAPQRRGLRGVEAPAPAGLD
Coding >Ophio5|6470
ATGGCTAACCGGGTCGACCGCATCGTCGCCCGCCTGCAGCAAAAGATTGTTGACGGCGACTTCTACGAGGCTCAG
CAGCAGACGCGCGTCGCCGCCTCTCGCCACATCAAGACGCGCAACTGGCCGGCCGCCATCGACATTCTCGCCAGC
GTCGCCCAGGCCCTACTGCGGGCGGGTCAGGGCGGCAGCGGAGGCGATCTCTGCGTCATGCTCGTCGACGTCTAC
GTACAGGCTCAGCTGCGGCCGGATGCCGAGGCCAAGGGCCGGTTGCTCACCTGCTTGCGTCTGTTTGACGCTGCC
GAGCCGACGAGGAAGCGCTTCATTAGCGATATGGTCAGCTGGTCGGCCAAGTTTGGAGACTATCCCGCTGGCGAT
CCCGAACTGCACCACGTTGCCGGATCCATCTACGCAGATGAGCACGAGCCGTACGAGGCAGAAAAACACTTGATT
CTCGGCACCAAGGATTCGCCCGAGGTGCTGGCCAAGATGGAATACGAATGGTACAAAGAGGGAGACGCCCATCTG
GCGCCTCACTTTGCCGCCCGCGCCATCCTCGGCTACCTGCTCGTCGGCAACCTGCGCGCCGCCAACGCGAGCCAC
CGCGTCTTCACCAGCGCGCTCAGCAGTGGAAACAGCGGGCTGAACGTCCAGGATGTCGCTAGCGCTGAAAGCGAC
CTGCGCGTCTTCCCCAGCCTGCCGCTCCTCAACTTTCTCGGTCTGCTGCTGCTGGCGGTGCCGCGGGGCGCGCCC
CAGGTGTACAGGGGCTTGGTGACCAAGTATGCCGCGCAGATCAACGACGTCGAAACCTGGGCCGAGTCGTTGGAG
CTCGTGGCCGAGCTGTACTTTGGCATCAGCCGACCGAGGCAGAGCAATCCGCTGATGGACATGATGAGCGGCTTG
TTCGGGGGCGGGGGAGGCGCGCCGCAGCGACGTGGCTTGCGAGGCGTGGAGGCGCCCGCTCCCGCCGGGCTGGAC
Transcript >Ophio5|6470
ATGGCTAACCGGGTCGACCGCATCGTCGCCCGCCTGCAGCAAAAGATTGTTGACGGCGACTTCTACGAGGCTCAG
CAGCAGACGCGCGTCGCCGCCTCTCGCCACATCAAGACGCGCAACTGGCCGGCCGCCATCGACATTCTCGCCAGC
GTCGCCCAGGCCCTACTGCGGGCGGGTCAGGGCGGCAGCGGAGGCGATCTCTGCGTCATGCTCGTCGACGTCTAC
GTACAGGCTCAGCTGCGGCCGGATGCCGAGGCCAAGGGCCGGTTGCTCACCTGCTTGCGTCTGTTTGACGCTGCC
GAGCCGACGAGGAAGCGCTTCATTAGCGATATGGTCAGCTGGTCGGCCAAGTTTGGAGACTATCCCGCTGGCGAT
CCCGAACTGCACCACGTTGCCGGATCCATCTACGCAGATGAGCACGAGCCGTACGAGGCAGAAAAACACTTGATT
CTCGGCACCAAGGATTCGCCCGAGGTGCTGGCCAAGATGGAATACGAATGGTACAAAGAGGGAGACGCCCATCTG
GCGCCTCACTTTGCCGCCCGCGCCATCCTCGGCTACCTGCTCGTCGGCAACCTGCGCGCCGCCAACGCGAGCCAC
CGCGTCTTCACCAGCGCGCTCAGCAGTGGAAACAGCGGGCTGAACGTCCAGGATGTCGCTAGCGCTGAAAGCGAC
CTGCGCGTCTTCCCCAGCCTGCCGCTCCTCAACTTTCTCGGTCTGCTGCTGCTGGCGGTGCCGCGGGGCGCGCCC
CAGGTGTACAGGGGCTTGGTGACCAAGTATGCCGCGCAGATCAACGACGTCGAAACCTGGGCCGAGTCGTTGGAG
CTCGTGGCCGAGCTGTACTTTGGCATCAGCCGACCGAGGCAGAGCAATCCGCTGATGGACATGATGAGCGGCTTG
TTCGGGGGCGGGGGAGGCGCGCCGCAGCGACGTGGCTTGCGAGGCGTGGAGGCGCCCGCTCCCGCCGGGCTGGAC
TAG
Gene >Ophio5|6470
ATGGCTAACCGGGTCGACCGCATCGTCGCCCGCCTGCAGCAAAAGATTGTTGACGGCGACTTCTACGAGGCTCAG
CAGCAGACGCGCGTCGCCGCCTCTCGCCACATCAAGACGCGCAACTGGCCGGCCGCCATCGACATTCTCGCCAGC
GTCGCCCAGGCCCTACTGCGGGCGGGTCAGGGCGGCAGCGGAGGCGATCTCTGCGTCATGCTCGTCGACGTCTAC
GTACAGGCTCAGCTGCGGCCGGATGCCGAGGCCAAGGGCCGGTTGCTCACCTGCTTGCGTCTGTTTGACGCTGCC
GAGCCGACGAGGAAGCGCTTCATTAGCGATATGGTCAGGTGAGATTTTTCAACTGCTGACACTTGGCATCTTGGC
TGCTGACACTTTTGTTTTTTTTTCATTTCTGTTTAGCTGGTCGGCCAAGTTTGGAGACTATCCCGCTGGCGATCC
CGAACTGCACCACGTTGCCGGATCCATCTACGCAGATGAGCACGAGCCGTACGAGGCAGAAAAACACTTGATTCT
CGGCACCAAGGATTCGCCCGAGGTGCTGGCCAAGATGGAATACGAATGGTACAAAGAGGGAGACGCCCATCTGGC
GCCTCACTTTGCCGCCCGCGCCATCCTCGGCTACCTGCTCGTCGGCAACCTGCGCGCCGCCAACGCGAGCCACCG
CGTCTTCACCAGCGCGCTCAGCAGTGGAAACAGCGGGCTGAACGTCCAGGATGTCGCTAGCGCTGAAAGCGACCT
GCGCGTCTTCCCCAGCCTGCCGCTCCTCAACTTTCTCGGTCTGCTGCTGCTGGCGGTGCCGCGGGGCGCGCCCCA
GGTGTACAGGGGCTTGGTGACCAAGTATGCCGCGCAGATCAACGACGTCGAAACCTGGGCCGAGTCGTTGGAGCT
CGTGGCCGAGCTGTACTTTGGCATCAGCCGACCGAGGCAGAGCAATCCGCTGATGGACATGATGAGCGGCTTGTT
CGGGGGCGGGGGAGGCGCGCCGCAGCGACGTGGCTTGCGAGGCGTGGAGGCGCCCGCTCCCGCCGGGCTGGACTA
G

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail