Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6467
Gene name
Locationscaffold_568:2668..3292
Strand+
Gene length (bp)624
Transcript length (bp)516
Coding sequence length (bp)513
Protein length (aa) 171

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05255 UPF0220 Uncharacterised protein family (UPF0220) 2.8E-65 4 165

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12016|VPS68_YEAST Vacuolar protein sorting-associated protein 68 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS68 PE=1 SV=1 21 171 1.0E-44
sp|O43073|YGW2_SCHPO UPF0220 protein C8D2.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi063 PE=3 SV=1 20 171 3.0E-44
sp|Q54T60|TMM50_DICDI Transmembrane protein 50 homolog OS=Dictyostelium discoideum GN=tmem50 PE=3 SV=1 28 128 5.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 17 39 22
2 59 78 19
3 99 121 22
4 136 158 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6467
MDDHRLWKFGRPEWLNSAWARSAGIYAAGALFSVAFYVMLDSAVWSKSARNGSNVHIRFVDWLPLIFSSLGMLII
NSIEKQRLSADSFSYSGSGVAWKARVVLFLGFAALAGGMAGGVTVFVLKFVVPGVSMPALGMGIENIISNALVGF
SSVVLWVSQNMEDEYSYNLAI
Coding >Ophio5|6467
ATGGATGACCACCGGCTCTGGAAGTTCGGCCGGCCCGAGTGGCTCAACAGCGCCTGGGCCCGCAGCGCCGGCATC
TACGCCGCAGGCGCCCTGTTCTCCGTCGCCTTCTACGTCATGCTCGATTCGGCCGTCTGGTCCAAATCGGCCCGC
AACGGGTCCAACGTCCACATCCGCTTCGTCGACTGGCTGCCCCTCATCTTCTCCAGCCTAGGCATGCTCATCATC
AACTCCATCGAGAAGCAGCGCCTCAGCGCCGACTCGTTCAGCTATAGTGGCTCTGGCGTCGCCTGGAAGGCCCGC
GTCGTCCTCTTTCTCGGCTTCGCTGCCCTGGCTGGCGGCATGGCTGGCGGCGTTACCGTATTTGTCCTCAAATTC
GTCGTCCCCGGCGTGTCCATGCCCGCCCTTGGAATGGGCATCGAAAACATCATCAGCAATGCCCTCGTCGGCTTC
AGCTCCGTTGTCCTGTGGGTCAGTCAGAATATGGAGGACGAGTACTCCTACAACCTGGCCATA
Transcript >Ophio5|6467
ATGGATGACCACCGGCTCTGGAAGTTCGGCCGGCCCGAGTGGCTCAACAGCGCCTGGGCCCGCAGCGCCGGCATC
TACGCCGCAGGCGCCCTGTTCTCCGTCGCCTTCTACGTCATGCTCGATTCGGCCGTCTGGTCCAAATCGGCCCGC
AACGGGTCCAACGTCCACATCCGCTTCGTCGACTGGCTGCCCCTCATCTTCTCCAGCCTAGGCATGCTCATCATC
AACTCCATCGAGAAGCAGCGCCTCAGCGCCGACTCGTTCAGCTATAGTGGCTCTGGCGTCGCCTGGAAGGCCCGC
GTCGTCCTCTTTCTCGGCTTCGCTGCCCTGGCTGGCGGCATGGCTGGCGGCGTTACCGTATTTGTCCTCAAATTC
GTCGTCCCCGGCGTGTCCATGCCCGCCCTTGGAATGGGCATCGAAAACATCATCAGCAATGCCCTCGTCGGCTTC
AGCTCCGTTGTCCTGTGGGTCAGTCAGAATATGGAGGACGAGTACTCCTACAACCTGGCCATATAA
Gene >Ophio5|6467
ATGGATGACCACCGGCTCTGGAAGTTCGGCCGGCCCGAGTGGCTCAACAGCGCCTGGGCCCGCAGCGCCGGCATC
TACGCCGCAGGCGCCCTGGTGCGTCATCCCCCTTCGACCCTCGTCTCCCTCTTGGGATGCTGACCGGCCCGCTCA
GTTCTCCGTCGCCTTCTACGTCATGCTCGATTCGGCCGTCTGGTCCAAATCGGCCCGCAACGGGTCCAACGTCCA
CATCCGCTTCGTCGACTGGCTGCCCCTCATCTTCTCCAGCCTAGGCATGCTCATCATCAACTCCATCGAGAAGCA
GCGCCTCAGCGCCGACTCGTTCAGCTATAGTGGCTCTGGCGTCGCCTGGAAGGCCCGCGTCGTCCTCTTTCTCGG
CTTCGCTGCCCTGGCTGGCGGCATGGCTGGCGGCGTTACCGTATTTGTCCTCAAATTCGTCGTCCCCGGCGTGTC
CATGCCCGCCCTTGGAATGGGCATCGAAAACATCATCAGCAATGCCCTCGTCGGCTTCAGGTATGGCTCCCCACA
CCCTGTCGCGCCGCCGGGTGCTTACCCACGTCCAGCTCCGTTGTCCTGTGGGTCAGTCAGAATATGGAGGACGAG
TACTCCTACAACCTGGCCATATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail