Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6459
Gene name
Locationscaffold_566:8735..9722
Strand-
Gene length (bp)987
Transcript length (bp)987
Coding sequence length (bp)984
Protein length (aa) 328

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 119.75 65.07 174.44
CcL In ants, during behavior modification 78.44 42.29 114.59
CcD In ants, recently dead 94.14 51.76 136.51

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.061312 no
SC16a CcD 0.311555 no
CcL CcD 0.456670 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6459
MPLAHVVIAPGVVVAVSVTMAVAMALYGSPELRRYADDARRRIAMAVHSFGDNIDPYRHGEPRFNRPEDADGFML
SSRDPGVDGDDETLRRQREELMYWNRMRLEKSKAEKEAVRQVVDDDDVDSSSRPVVYGSGADARPATSGLRHRRE
ASNLAPASAVYYANPFADEHAASDIYSATTRDAEDDFHSATLAPSPPAALIDLPPMPDSPSAAHRQESYASIQAW
AQDSSNHNLLSSSLHANPAVAVPESEPDMLSDGQLTPTATDLSAPSLVGSAEHLSQPAEEDDDDEAGRPFDVLSE
SSGMDTPASWSELGSVVSENESLGPLQA
Coding >Ophio5|6459
ATGCCGCTCGCCCACGTCGTCATCGCTCCGGGCGTCGTCGTCGCCGTCTCCGTTACAATGGCCGTGGCCATGGCC
CTATACGGCTCTCCCGAACTGCGTCGTTATGCAGACGATGCGCGACGTCGTATCGCCATGGCTGTGCATTCGTTT
GGGGATAATATCGACCCGTATCGTCACGGTGAACCGCGCTTTAATCGTCCCGAGGACGCCGATGGCTTTATGCTC
TCCTCCCGCGATCCGGGCGTCGATGGCGATGACGAGACGCTGAGGAGACAGCGTGAAGAGTTGATGTATTGGAAT
CGCATGCGTCTGGAAAAGTCAAAAGCGGAAAAAGAGGCCGTCAGGCAGGTTGTTGACGACGACGACGTCGACTCC
TCTTCGCGCCCTGTCGTTTACGGCTCCGGCGCCGATGCCCGTCCCGCTACTTCGGGTCTTCGACACCGCCGAGAG
GCATCGAATCTGGCCCCGGCCTCGGCAGTGTATTACGCTAACCCCTTTGCCGACGAGCACGCCGCTTCAGACATC
TACAGCGCCACCACCCGCGACGCAGAAGACGACTTCCATAGCGCCACGCTCGCACCCTCACCCCCCGCCGCCCTC
ATCGACCTCCCTCCGATGCCCGATTCTCCATCGGCCGCTCACCGCCAGGAATCCTACGCCTCCATCCAAGCCTGG
GCCCAAGACTCGAGTAACCACAACCTCCTCTCGTCCTCTCTCCACGCCAACCCCGCCGTTGCCGTGCCCGAGTCG
GAGCCCGACATGCTCAGCGATGGTCAGCTCACGCCAACGGCGACGGACCTCTCGGCCCCTTCGCTCGTCGGCTCC
GCTGAGCACCTATCTCAGCCTGCTGAAGAGGACGACGACGACGAAGCTGGTCGCCCATTTGACGTCCTGAGCGAG
AGCAGTGGCATGGATACGCCTGCGAGCTGGTCCGAGTTGGGTAGCGTTGTTAGCGAGAATGAGTCTCTCGGGCCG
CTGCAAGCG
Transcript >Ophio5|6459
ATGCCGCTCGCCCACGTCGTCATCGCTCCGGGCGTCGTCGTCGCCGTCTCCGTTACAATGGCCGTGGCCATGGCC
CTATACGGCTCTCCCGAACTGCGTCGTTATGCAGACGATGCGCGACGTCGTATCGCCATGGCTGTGCATTCGTTT
GGGGATAATATCGACCCGTATCGTCACGGTGAACCGCGCTTTAATCGTCCCGAGGACGCCGATGGCTTTATGCTC
TCCTCCCGCGATCCGGGCGTCGATGGCGATGACGAGACGCTGAGGAGACAGCGTGAAGAGTTGATGTATTGGAAT
CGCATGCGTCTGGAAAAGTCAAAAGCGGAAAAAGAGGCCGTCAGGCAGGTTGTTGACGACGACGACGTCGACTCC
TCTTCGCGCCCTGTCGTTTACGGCTCCGGCGCCGATGCCCGTCCCGCTACTTCGGGTCTTCGACACCGCCGAGAG
GCATCGAATCTGGCCCCGGCCTCGGCAGTGTATTACGCTAACCCCTTTGCCGACGAGCACGCCGCTTCAGACATC
TACAGCGCCACCACCCGCGACGCAGAAGACGACTTCCATAGCGCCACGCTCGCACCCTCACCCCCCGCCGCCCTC
ATCGACCTCCCTCCGATGCCCGATTCTCCATCGGCCGCTCACCGCCAGGAATCCTACGCCTCCATCCAAGCCTGG
GCCCAAGACTCGAGTAACCACAACCTCCTCTCGTCCTCTCTCCACGCCAACCCCGCCGTTGCCGTGCCCGAGTCG
GAGCCCGACATGCTCAGCGATGGTCAGCTCACGCCAACGGCGACGGACCTCTCGGCCCCTTCGCTCGTCGGCTCC
GCTGAGCACCTATCTCAGCCTGCTGAAGAGGACGACGACGACGAAGCTGGTCGCCCATTTGACGTCCTGAGCGAG
AGCAGTGGCATGGATACGCCTGCGAGCTGGTCCGAGTTGGGTAGCGTTGTTAGCGAGAATGAGTCTCTCGGGCCG
CTGCAAGCGTAG
Gene >Ophio5|6459
ATGCCGCTCGCCCACGTCGTCATCGCTCCGGGCGTCGTCGTCGCCGTCTCCGTTACAATGGCCGTGGCCATGGCC
CTATACGGCTCTCCCGAACTGCGTCGTTATGCAGACGATGCGCGACGTCGTATCGCCATGGCTGTGCATTCGTTT
GGGGATAATATCGACCCGTATCGTCACGGTGAACCGCGCTTTAATCGTCCCGAGGACGCCGATGGCTTTATGCTC
TCCTCCCGCGATCCGGGCGTCGATGGCGATGACGAGACGCTGAGGAGACAGCGTGAAGAGTTGATGTATTGGAAT
CGCATGCGTCTGGAAAAGTCAAAAGCGGAAAAAGAGGCCGTCAGGCAGGTTGTTGACGACGACGACGTCGACTCC
TCTTCGCGCCCTGTCGTTTACGGCTCCGGCGCCGATGCCCGTCCCGCTACTTCGGGTCTTCGACACCGCCGAGAG
GCATCGAATCTGGCCCCGGCCTCGGCAGTGTATTACGCTAACCCCTTTGCCGACGAGCACGCCGCTTCAGACATC
TACAGCGCCACCACCCGCGACGCAGAAGACGACTTCCATAGCGCCACGCTCGCACCCTCACCCCCCGCCGCCCTC
ATCGACCTCCCTCCGATGCCCGATTCTCCATCGGCCGCTCACCGCCAGGAATCCTACGCCTCCATCCAAGCCTGG
GCCCAAGACTCGAGTAACCACAACCTCCTCTCGTCCTCTCTCCACGCCAACCCCGCCGTTGCCGTGCCCGAGTCG
GAGCCCGACATGCTCAGCGATGGTCAGCTCACGCCAACGGCGACGGACCTCTCGGCCCCTTCGCTCGTCGGCTCC
GCTGAGCACCTATCTCAGCCTGCTGAAGAGGACGACGACGACGAAGCTGGTCGCCCATTTGACGTCCTGAGCGAG
AGCAGTGGCATGGATACGCCTGCGAGCTGGTCCGAGTTGGGTAGCGTTGTTAGCGAGAATGAGTCTCTCGGGCCG
CTGCAAGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail