Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6457
Gene name
Locationscaffold_566:445..3956
Strand-
Gene length (bp)3511
Transcript length (bp)3336
Coding sequence length (bp)3333
Protein length (aa) 1111

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12348 CLASP_N CLASP N terminal 1.2E-43 8 219
PF12348 CLASP_N CLASP N terminal 3.1E-88 282 507

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H0S9|STU1_CHAGB Protein STU1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=STU1 PE=3 SV=1 6 1111 0.0E+00
sp|Q7S9L2|STU1_NEUCR Protein stu-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stu-1 PE=3 SV=1 1 1110 0.0E+00
sp|Q4I9B7|STU1_GIBZE Protein STU1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=STU1 PE=3 SV=1 1 1110 0.0E+00
sp|Q0UQJ8|STU1_PHANO Protein STU1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=STU1 PE=3 SV=1 6 1105 3.0E-173
sp|Q2UCC9|STU1_ASPOR Protein stu1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=stu1 PE=3 SV=2 10 1105 6.0E-172
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H0S9|STU1_CHAGB Protein STU1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=STU1 PE=3 SV=1 6 1111 0.0E+00
sp|Q7S9L2|STU1_NEUCR Protein stu-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stu-1 PE=3 SV=1 1 1110 0.0E+00
sp|Q4I9B7|STU1_GIBZE Protein STU1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=STU1 PE=3 SV=1 1 1110 0.0E+00
sp|Q0UQJ8|STU1_PHANO Protein STU1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=STU1 PE=3 SV=1 6 1105 3.0E-173
sp|Q2UCC9|STU1_ASPOR Protein stu1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=stu1 PE=3 SV=2 10 1105 6.0E-172
sp|Q1DS65|STU1_COCIM Protein STU1 OS=Coccidioides immitis (strain RS) GN=STU1 PE=3 SV=2 268 630 3.0E-116
sp|Q4WSI0|STU1_ASPFU Protein stu1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=stu1 PE=3 SV=2 264 640 2.0E-107
sp|Q4P5R8|STU1_USTMA Protein STU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=STU1 PE=3 SV=2 8 505 6.0E-63
sp|Q6C882|STU1_YARLI Protein STU1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STU1 PE=3 SV=2 12 523 2.0E-59
sp|Q5BEN5|STU1_EMENI Protein stu1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stu1 PE=3 SV=2 271 1110 4.0E-59
sp|P0CM74|STU1_CRYNJ Protein STU1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=STU1 PE=3 SV=1 131 516 7.0E-55
sp|P0CM75|STU1_CRYNB Protein STU1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=STU1 PE=3 SV=1 131 516 7.0E-55
sp|Q1DS65|STU1_COCIM Protein STU1 OS=Coccidioides immitis (strain RS) GN=STU1 PE=3 SV=2 8 228 3.0E-52
sp|Q4WSI0|STU1_ASPFU Protein stu1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=stu1 PE=3 SV=2 10 244 1.0E-50
sp|Q59WD5|STU1_CANAL Protein STU1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=STU1 PE=3 SV=1 1 626 5.0E-50
sp|O42874|STU1_SCHPO Protein peg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=peg1 PE=1 SV=1 6 526 4.0E-46
sp|Q6BK07|STU1_DEBHA Protein STU1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STU1 PE=3 SV=2 270 551 6.0E-40
sp|Q75B70|STU1_ASHGO Protein STU1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STU1 PE=3 SV=2 27 487 9.0E-35
sp|Q5BEN5|STU1_EMENI Protein stu1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stu1 PE=3 SV=2 8 228 7.0E-32
sp|Q6CVG0|STU1_KLULA Protein STU1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STU1 PE=3 SV=1 230 489 7.0E-31
sp|Q4WSI0|STU1_ASPFU Protein stu1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=stu1 PE=3 SV=2 865 1105 6.0E-30
sp|Q7Z460|CLAP1_HUMAN CLIP-associating protein 1 OS=Homo sapiens GN=CLASP1 PE=1 SV=1 51 516 1.0E-22
sp|A1A5G0|CLAP1_XENTR CLIP-associating protein 1 OS=Xenopus tropicalis GN=clasp1 PE=1 SV=1 51 516 2.0E-21
sp|P38198|STU1_YEAST Protein STU1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STU1 PE=1 SV=1 296 658 9.0E-21
sp|Q9NBD7|CLASP_DROME CLIP-associating protein OS=Drosophila melanogaster GN=chb PE=1 SV=1 50 733 4.0E-20
sp|Q4U0G1|CLA1A_XENLA CLIP-associating protein 1-A OS=Xenopus laevis GN=clasp1-a PE=2 SV=2 51 516 5.0E-20
sp|A1A5K2|CLA1B_XENLA CLIP-associating protein 1-B OS=Xenopus laevis GN=clasp1b PE=1 SV=1 297 516 7.0E-15
sp|Q80TV8|CLAP1_MOUSE CLIP-associating protein 1 OS=Mus musculus GN=Clasp1 PE=1 SV=2 297 516 8.0E-15
sp|Q6BK07|STU1_DEBHA Protein STU1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STU1 PE=3 SV=2 25 228 1.0E-13
sp|Q6NYW6|CLAP2_DANRE CLIP-associating protein 2 OS=Danio rerio GN=clasp2 PE=2 SV=1 276 507 3.0E-13
sp|Q8BRT1|CLAP2_MOUSE CLIP-associating protein 2 OS=Mus musculus GN=Clasp2 PE=1 SV=1 242 507 9.0E-13
sp|Q99JD4|CLAP2_RAT CLIP-associating protein 2 OS=Rattus norvegicus GN=Clasp2 PE=1 SV=1 274 507 1.0E-12
sp|O75122|CLAP2_HUMAN CLIP-associating protein 2 OS=Homo sapiens GN=CLASP2 PE=1 SV=2 274 507 2.0E-12
sp|Q8RWY6|CLASP_ARATH CLIP-associated protein OS=Arabidopsis thaliana GN=CLASP PE=1 SV=1 54 510 3.0E-12
sp|Q54VQ0|Y6442_DICDI Uncharacterized protein DDB_G0280205 OS=Dictyostelium discoideum GN=DDB_G0280205 PE=4 SV=2 273 507 5.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6457
MAETKLTDQQVADLVALLRGDASFDVKVQHVTAVKSGIKQHNVPEASAPLLFDGLRIASGSQHAALVNAGFTALN
HLLTRLSRQEPRLLAKEAARTLPVIVDRLGDHKDKFRALASQALATLYLVAPVDVERAVRNQAMVGKNSRAKEAA
MQWLLQMHQEQGLQFRAYVPLLMELLEDADGMVRDAAKSTVIELFKTAPNGAKSDLKRQLKNFKVRPAIEQAIVK
TLGPIGRPDTPSEAAPPSRTNLAASVSSLMSERAATPVADVQAEAIEPMYVNTHRELEDLFRDMICHFDGKETEQ
NWMKREQAMGTLRKLTAGNAPADFPDTFLAGLRNMLDGIIKATNSLRTSLSKEGCGLVQDMAVTLGPAMDPMVEL
LMQTFVKLSAGTKKISSQLANVTVDTIIARVTYTGRLMQHIWGACQDKNVQPRMYTTGWLKTLLKKEAHHKSHVE
HTGGVDLMEKCIKKGLGDANPGVREKMRSTYWAFWAVWPARADAIMADLDSTAQKLLSKDPSNPNSPKKGTEPAR
PGLGLSKSTTTAGKPSVREAMMAQRKANMAAKNLPPRPGSAMAHISPVRSTSSSLGHAPKPTGTRARQEPTISVN
AGGMSVAPMRPARRRADVARPATAGPYSVRDRPVAMEAASPESTNSRGATPKEKESTPRRTAQRPRLGIAPVTGE
TNGASPTTRSASRIPSPRGSPPTRLARSATAVSPGSPKVYEDMTLVVPEMPSIAAALMRKQPTNEVVEKQTETTV
EEKPPSEVETPTKEKLSTESETAFKETMPSQEETASRELTASEEKPLESETLAPQTESPSRALKVFEDPFRDDDS
PQKPTMSVPVLGDKPINEDAAQLQLKANGASVSTEPASSPEKARQNSRLLDSGINKIKAKTLEVHGFRKLQSLIR
DGKTAIPDDKFEPLVLGLFSYLEDPLEGLAADKAQDVKAQMLATMKLLLRRERESFRPYVGRGLESLLVTRSGYD
AKAHVVSGLELLADELVSLGDSSELIVVLGRRLESCCDQDSSSGGCRTLSMGLDIVRQVLEKQMVPESDVDQLVR
LARRTLASTDSGVRMAAVKLCVALHLRLGHGPFWSAMEAVADEAKSLITYYVVKRERELAA
Coding >Ophio5|6457
ATGGCCGAAACCAAGCTCACCGACCAGCAGGTCGCCGACCTGGTAGCACTGTTGCGCGGCGACGCCAGCTTCGAC
GTCAAGGTCCAGCACGTCACGGCCGTCAAGTCCGGCATCAAGCAGCACAACGTGCCCGAGGCCAGCGCTCCCCTC
CTCTTCGATGGCCTGCGCATCGCATCCGGCTCGCAGCACGCCGCCCTCGTCAACGCCGGCTTCACTGCGCTCAAC
CACCTCCTCACCCGTCTTTCGCGCCAGGAGCCCCGTCTGCTCGCAAAGGAGGCGGCCCGAACGCTGCCCGTTATT
GTCGATAGGCTGGGCGACCACAAGGACAAGTTCCGAGCCCTGGCGTCTCAGGCTCTGGCCACTCTCTACCTTGTC
GCCCCTGTCGACGTGGAGCGCGCCGTTAGAAATCAGGCTATGGTTGGCAAGAACTCGAGGGCCAAGGAAGCAGCC
ATGCAGTGGCTCTTGCAGATGCATCAGGAGCAAGGCTTGCAGTTCCGTGCCTACGTACCGTTGCTCATGGAGCTG
CTCGAGGATGCCGATGGCATGGTTCGAGATGCTGCTAAGAGCACCGTCATCGAGCTCTTCAAGACGGCGCCCAAC
GGCGCCAAGTCGGACCTCAAGCGGCAGCTGAAAAACTTCAAGGTGCGGCCTGCCATTGAGCAGGCCATCGTCAAG
ACGCTCGGCCCTATCGGTCGGCCTGATACGCCCTCCGAAGCGGCGCCGCCAAGCCGTACGAATCTGGCAGCCAGC
GTATCCTCCCTCATGAGCGAGCGCGCAGCCACCCCCGTGGCCGACGTGCAGGCCGAGGCCATCGAGCCCATGTAC
GTCAACACGCACCGCGAGCTCGAAGACTTGTTCCGCGACATGATCTGCCACTTCGACGGCAAGGAGACGGAGCAG
AACTGGATGAAGCGCGAGCAGGCCATGGGAACGCTGCGCAAGCTTACGGCTGGAAACGCGCCGGCCGACTTTCCC
GACACCTTCCTGGCCGGGCTGCGGAATATGTTGGATGGCATTATCAAGGCCACCAACTCGCTGCGCACGAGCTTG
TCCAAAGAAGGCTGCGGCCTTGTCCAGGACATGGCAGTCACCCTCGGGCCTGCCATGGACCCCATGGTCGAGCTG
CTGATGCAGACGTTCGTCAAGCTCTCGGCCGGGACCAAGAAGATCAGCTCGCAGCTGGCAAACGTCACCGTCGAC
ACCATCATCGCTCGCGTGACGTACACGGGACGGCTGATGCAGCACATATGGGGCGCCTGCCAGGACAAGAACGTG
CAGCCGAGGATGTACACGACGGGCTGGCTGAAGACGCTGCTCAAGAAGGAGGCTCATCACAAGAGCCACGTCGAG
CACACGGGCGGCGTCGACCTGATGGAGAAGTGCATCAAGAAGGGCCTCGGCGATGCGAACCCCGGCGTGAGGGAG
AAGATGAGGTCGACCTACTGGGCCTTTTGGGCTGTCTGGCCGGCCAGGGCCGACGCGATCATGGCCGATCTGGAC
TCGACGGCCCAGAAGCTCCTCAGCAAGGACCCGAGCAACCCCAACTCGCCCAAGAAGGGGACCGAGCCGGCACGA
CCGGGTCTTGGCCTGTCGAAGAGCACCACGACAGCAGGAAAGCCCAGCGTCCGCGAGGCCATGATGGCGCAGAGA
AAGGCCAACATGGCGGCCAAGAACCTGCCGCCGCGGCCCGGATCGGCCATGGCGCACATCTCCCCCGTTCGCTCC
ACGTCCAGCTCGTTGGGCCATGCGCCCAAGCCGACCGGGACACGAGCGCGCCAGGAGCCGACCATCTCGGTCAAC
GCCGGGGGCATGTCGGTGGCTCCCATGCGGCCCGCCAGGAGGAGAGCCGACGTGGCCCGTCCGGCGACGGCCGGC
CCCTATTCGGTGCGAGACCGGCCCGTGGCGATGGAGGCCGCCAGCCCGGAGAGCACCAACTCGAGGGGCGCGACG
CCCAAGGAGAAGGAGTCGACGCCGAGGAGAACGGCGCAACGGCCGCGGCTGGGCATAGCGCCCGTGACAGGCGAG
ACAAACGGCGCGTCGCCGACGACGCGATCTGCTTCGAGGATACCCTCTCCCCGAGGGAGTCCCCCGACGAGACTT
GCACGGAGCGCGACGGCCGTGTCGCCCGGGTCTCCCAAGGTGTACGAGGATATGACGCTTGTGGTGCCGGAGATG
CCCAGCATAGCGGCGGCCTTGATGCGGAAGCAGCCGACGAACGAGGTGGTAGAGAAGCAGACAGAGACAACGGTG
GAGGAGAAGCCGCCGTCGGAAGTAGAGACACCGACCAAGGAGAAGCTGTCGACGGAGTCAGAGACGGCGTTCAAG
GAGACCATGCCCTCGCAGGAAGAGACGGCGTCGAGGGAGCTGACAGCGTCGGAAGAGAAGCCCCTGGAATCAGAG
ACGCTCGCACCACAGACGGAGTCGCCGTCGCGCGCCCTCAAGGTGTTTGAAGATCCCTTCAGGGACGACGACTCG
CCGCAGAAGCCGACGATGAGCGTGCCGGTGCTGGGCGACAAGCCCATCAACGAAGATGCCGCACAACTTCAGCTG
AAGGCCAACGGCGCCTCAGTCTCGACGGAGCCCGCCAGCTCGCCGGAAAAGGCGCGGCAGAACTCGCGCCTACTG
GACAGCGGCATCAACAAGATCAAGGCCAAGACACTCGAGGTGCATGGCTTCCGCAAGCTGCAGTCGCTCATCCGC
GACGGGAAGACGGCCATTCCGGACGACAAGTTCGAGCCCCTTGTACTCGGCCTTTTCAGTTACCTGGAGGATCCG
CTAGAAGGCCTCGCGGCGGATAAGGCGCAGGACGTCAAGGCGCAGATGCTGGCGACGATGAAGCTTCTCCTCCGA
CGCGAGAGAGAAAGCTTCAGACCGTATGTGGGCCGAGGCCTCGAGTCTCTCCTGGTGACGCGCAGCGGCTACGAC
GCAAAGGCGCACGTCGTCAGCGGTCTCGAGCTCCTCGCCGACGAACTCGTCTCCCTCGGCGACTCGTCCGAGCTC
ATCGTCGTGCTCGGCCGTCGTCTCGAAAGCTGCTGCGACCAAGATTCTTCGTCCGGAGGCTGTCGCACCCTCAGC
ATGGGTCTGGACATTGTCCGCCAAGTGCTGGAGAAGCAGATGGTACCAGAAAGCGACGTCGACCAGCTCGTCCGT
CTTGCTCGTCGGACCCTCGCCTCCACCGACTCGGGCGTCCGTATGGCGGCCGTCAAGCTCTGCGTCGCGCTGCAT
CTCCGTCTCGGCCACGGCCCGTTTTGGTCCGCCATGGAGGCTGTTGCCGATGAAGCCAAGAGTCTGATAACCTAT
TATGTCGTCAAGCGGGAGCGCGAGCTGGCCGCT
Transcript >Ophio5|6457
ATGGCCGAAACCAAGCTCACCGACCAGCAGGTCGCCGACCTGGTAGCACTGTTGCGCGGCGACGCCAGCTTCGAC
GTCAAGGTCCAGCACGTCACGGCCGTCAAGTCCGGCATCAAGCAGCACAACGTGCCCGAGGCCAGCGCTCCCCTC
CTCTTCGATGGCCTGCGCATCGCATCCGGCTCGCAGCACGCCGCCCTCGTCAACGCCGGCTTCACTGCGCTCAAC
CACCTCCTCACCCGTCTTTCGCGCCAGGAGCCCCGTCTGCTCGCAAAGGAGGCGGCCCGAACGCTGCCCGTTATT
GTCGATAGGCTGGGCGACCACAAGGACAAGTTCCGAGCCCTGGCGTCTCAGGCTCTGGCCACTCTCTACCTTGTC
GCCCCTGTCGACGTGGAGCGCGCCGTTAGAAATCAGGCTATGGTTGGCAAGAACTCGAGGGCCAAGGAAGCAGCC
ATGCAGTGGCTCTTGCAGATGCATCAGGAGCAAGGCTTGCAGTTCCGTGCCTACGTACCGTTGCTCATGGAGCTG
CTCGAGGATGCCGATGGCATGGTTCGAGATGCTGCTAAGAGCACCGTCATCGAGCTCTTCAAGACGGCGCCCAAC
GGCGCCAAGTCGGACCTCAAGCGGCAGCTGAAAAACTTCAAGGTGCGGCCTGCCATTGAGCAGGCCATCGTCAAG
ACGCTCGGCCCTATCGGTCGGCCTGATACGCCCTCCGAAGCGGCGCCGCCAAGCCGTACGAATCTGGCAGCCAGC
GTATCCTCCCTCATGAGCGAGCGCGCAGCCACCCCCGTGGCCGACGTGCAGGCCGAGGCCATCGAGCCCATGTAC
GTCAACACGCACCGCGAGCTCGAAGACTTGTTCCGCGACATGATCTGCCACTTCGACGGCAAGGAGACGGAGCAG
AACTGGATGAAGCGCGAGCAGGCCATGGGAACGCTGCGCAAGCTTACGGCTGGAAACGCGCCGGCCGACTTTCCC
GACACCTTCCTGGCCGGGCTGCGGAATATGTTGGATGGCATTATCAAGGCCACCAACTCGCTGCGCACGAGCTTG
TCCAAAGAAGGCTGCGGCCTTGTCCAGGACATGGCAGTCACCCTCGGGCCTGCCATGGACCCCATGGTCGAGCTG
CTGATGCAGACGTTCGTCAAGCTCTCGGCCGGGACCAAGAAGATCAGCTCGCAGCTGGCAAACGTCACCGTCGAC
ACCATCATCGCTCGCGTGACGTACACGGGACGGCTGATGCAGCACATATGGGGCGCCTGCCAGGACAAGAACGTG
CAGCCGAGGATGTACACGACGGGCTGGCTGAAGACGCTGCTCAAGAAGGAGGCTCATCACAAGAGCCACGTCGAG
CACACGGGCGGCGTCGACCTGATGGAGAAGTGCATCAAGAAGGGCCTCGGCGATGCGAACCCCGGCGTGAGGGAG
AAGATGAGGTCGACCTACTGGGCCTTTTGGGCTGTCTGGCCGGCCAGGGCCGACGCGATCATGGCCGATCTGGAC
TCGACGGCCCAGAAGCTCCTCAGCAAGGACCCGAGCAACCCCAACTCGCCCAAGAAGGGGACCGAGCCGGCACGA
CCGGGTCTTGGCCTGTCGAAGAGCACCACGACAGCAGGAAAGCCCAGCGTCCGCGAGGCCATGATGGCGCAGAGA
AAGGCCAACATGGCGGCCAAGAACCTGCCGCCGCGGCCCGGATCGGCCATGGCGCACATCTCCCCCGTTCGCTCC
ACGTCCAGCTCGTTGGGCCATGCGCCCAAGCCGACCGGGACACGAGCGCGCCAGGAGCCGACCATCTCGGTCAAC
GCCGGGGGCATGTCGGTGGCTCCCATGCGGCCCGCCAGGAGGAGAGCCGACGTGGCCCGTCCGGCGACGGCCGGC
CCCTATTCGGTGCGAGACCGGCCCGTGGCGATGGAGGCCGCCAGCCCGGAGAGCACCAACTCGAGGGGCGCGACG
CCCAAGGAGAAGGAGTCGACGCCGAGGAGAACGGCGCAACGGCCGCGGCTGGGCATAGCGCCCGTGACAGGCGAG
ACAAACGGCGCGTCGCCGACGACGCGATCTGCTTCGAGGATACCCTCTCCCCGAGGGAGTCCCCCGACGAGACTT
GCACGGAGCGCGACGGCCGTGTCGCCCGGGTCTCCCAAGGTGTACGAGGATATGACGCTTGTGGTGCCGGAGATG
CCCAGCATAGCGGCGGCCTTGATGCGGAAGCAGCCGACGAACGAGGTGGTAGAGAAGCAGACAGAGACAACGGTG
GAGGAGAAGCCGCCGTCGGAAGTAGAGACACCGACCAAGGAGAAGCTGTCGACGGAGTCAGAGACGGCGTTCAAG
GAGACCATGCCCTCGCAGGAAGAGACGGCGTCGAGGGAGCTGACAGCGTCGGAAGAGAAGCCCCTGGAATCAGAG
ACGCTCGCACCACAGACGGAGTCGCCGTCGCGCGCCCTCAAGGTGTTTGAAGATCCCTTCAGGGACGACGACTCG
CCGCAGAAGCCGACGATGAGCGTGCCGGTGCTGGGCGACAAGCCCATCAACGAAGATGCCGCACAACTTCAGCTG
AAGGCCAACGGCGCCTCAGTCTCGACGGAGCCCGCCAGCTCGCCGGAAAAGGCGCGGCAGAACTCGCGCCTACTG
GACAGCGGCATCAACAAGATCAAGGCCAAGACACTCGAGGTGCATGGCTTCCGCAAGCTGCAGTCGCTCATCCGC
GACGGGAAGACGGCCATTCCGGACGACAAGTTCGAGCCCCTTGTACTCGGCCTTTTCAGTTACCTGGAGGATCCG
CTAGAAGGCCTCGCGGCGGATAAGGCGCAGGACGTCAAGGCGCAGATGCTGGCGACGATGAAGCTTCTCCTCCGA
CGCGAGAGAGAAAGCTTCAGACCGTATGTGGGCCGAGGCCTCGAGTCTCTCCTGGTGACGCGCAGCGGCTACGAC
GCAAAGGCGCACGTCGTCAGCGGTCTCGAGCTCCTCGCCGACGAACTCGTCTCCCTCGGCGACTCGTCCGAGCTC
ATCGTCGTGCTCGGCCGTCGTCTCGAAAGCTGCTGCGACCAAGATTCTTCGTCCGGAGGCTGTCGCACCCTCAGC
ATGGGTCTGGACATTGTCCGCCAAGTGCTGGAGAAGCAGATGGTACCAGAAAGCGACGTCGACCAGCTCGTCCGT
CTTGCTCGTCGGACCCTCGCCTCCACCGACTCGGGCGTCCGTATGGCGGCCGTCAAGCTCTGCGTCGCGCTGCAT
CTCCGTCTCGGCCACGGCCCGTTTTGGTCCGCCATGGAGGCTGTTGCCGATGAAGCCAAGAGTCTGATAACCTAT
TATGTCGTCAAGCGGGAGCGCGAGCTGGCCGCTTGA
Gene >Ophio5|6457
ATGGCCGAAACCAAGCTCACCGACCAGCAGGTCGCCGACCTGGTAGCACTGTTGCGCGGCGACGCCAGCTTCGAC
GTCAAGGTCCAGCACGTCACGGCCGTCAAGTCCGGCATCAAGCAGCACAACGTGCCCGAGGCCAGCGCTCCCCTC
CTCTTCGATGGCCTGCGCATCGCATCCGGCTCGCAGCACGCCGCCCTCGTCAACGCCGGCTTCACTGCGCTCAAC
CACCTCCTCACCCGTCTTTCGCGCCAGGAGCCCCGTCTGCTCGCAAAGGAGGCGGCCCGAACGCTGCCCGTTATT
GTCGATAGGCTGGGCGACCACAAGGACAAGTTCCGAGCCCTGGCGTCTCAGGCTCTGGCCACTCTCTACCTTGTC
GCCCCTGTCGACGTGGAGCGCGCCGTTAGAAATCAGGCTATGGTTGGCAAGAACTCGAGGGCCAAGGAAGCAGCC
ATGCAGTGGCTCTTGCAGGTACGCAAATTTAGTCGCCGCCGTTGTGCGCCAGAAGAGAAACTGATGGGTCCGCGG
CTCAGATGCATCAGGAGCAAGGCTTGCAGTTCCGTGCCTACGTACCGTTGCTCATGGAGCTGCTCGAGGATGCCG
ATGGCATGGTTCGAGATGCTGCTAAGAGCACCGTCATCGAGCTCTTCAAGTACGCTCTCTACTGACTGATCCATA
CTCTTTGCTGGCCGCTGACGACGACTAGGACGGCGCCCAACGGCGCCAAGTCGGACCTCAAGCGGCAGCTGAAAA
ACTTCAAGGTGCGGCCTGCCATTGAGCAGGCCATCGTCAAGACGCTCGGCCCTATCGGTCGGCCTGATACGCCCT
CCGAAGCGGCGCCGCCAAGCCGTACGAATCTGGCAGCCAGCGTATCCTCCCTCATGAGCGAGCGCGCAGCCACCC
CCGTGGCCGACGTGCAGGCCGAGGCCATCGAGCCCATGTACGTCAACACGCACCGCGAGCTCGAAGACTTGTTCC
GCGACATGATCTGCCACTTCGACGGCAAGGAGACGGAGCAGAACTGGATGAAGCGCGAGCAGGCCATGGGAACGC
TGCGCAAGCTTACGGCTGGAAACGCGCCGGCCGACTTTCCCGACACCTTCCTGGCCGGGCTGCGGAATATGTTGG
ATGGCATTATCAAGGCCACCAACTCGCTGCGCACGAGCTTGTCCAAAGAAGGCTGCGGCCTTGTCCAGGACATGG
CAGTCACCCTCGGGCCTGCCATGGACCCCATGGTCGAGCTGCTGATGCAGACGTTCGTCAAGCTCTCGGCCGGGA
CCAAGAAGATCAGCTCGCAGCTGGCAAACGTCACCGTCGACACCATCATCGCTCGCGTGACGTACACGGGACGGC
TGATGCAGCACATATGGGGCGCCTGCCAGGACAAGAACGTGCAGCCGAGGATGTACACGACGGGCTGGCTGAAGA
CGCTGCTCAAGAAGGAGGCTCATCACAAGAGCCACGTCGAGCACACGGGCGGCGTCGACCTGATGGAGAAGTGCA
TCAAGAAGGGCCTCGGCGATGCGAACCCCGGCGTGAGGGAGAAGATGAGGTCGACCTACTGGGCCTTTTGGGCTG
TCTGGCCGGCCAGGGCCGACGCGTACGTCGTCAAGCTGTGCTGCCTCGACTGATGCCACGGAAACTAACAGCTCC
TTGTAGGATCATGGCCGATCTGGACTCGACGGCCCAGAAGCTCCTCAGCAAGGACCCGAGCAACCCCAACTCGCC
CAAGAAGGGGACCGAGCCGGCACGACCGGGTCTTGGCCTGTCGAAGAGCACCACGACAGCAGGAAAGCCCAGCGT
CCGCGAGGCCATGATGGCGCAGAGAAAGGCCAACATGGCGGCCAAGAACCTGCCGCCGCGGCCCGGATCGGCCAT
GGCGCACATCTCCCCCGTTCGCTCCACGTCCAGCTCGTTGGGCCATGCGCCCAAGCCGACCGGGACACGAGCGCG
CCAGGAGCCGACCATCTCGGTCAACGCCGGGGGCATGTCGGTGGCTCCCATGCGGCCCGCCAGGAGGAGAGCCGA
CGTGGCCCGTCCGGCGACGGCCGGCCCCTATTCGGTGCGAGACCGGCCCGTGGCGATGGAGGCCGCCAGCCCGGA
GAGCACCAACTCGAGGGGCGCGACGCCCAAGGAGAAGGAGTCGACGCCGAGGAGAACGGCGCAACGGCCGCGGCT
GGGCATAGCGCCCGTGACAGGCGAGACAAACGGCGCGTCGCCGACGACGCGATCTGCTTCGAGGATACCCTCTCC
CCGAGGGAGTCCCCCGACGAGACTTGCACGGAGCGCGACGGCCGTGTCGCCCGGGTCTCCCAAGGTGTACGAGGA
TATGACGCTTGTGGTGCCGGAGATGCCCAGCATAGCGGCGGCCTTGATGCGGAAGCAGCCGACGAACGAGGTGGT
AGAGAAGCAGACAGAGACAACGGTGGAGGAGAAGCCGCCGTCGGAAGTAGAGACACCGACCAAGGAGAAGCTGTC
GACGGAGTCAGAGACGGCGTTCAAGGAGACCATGCCCTCGCAGGAAGAGACGGCGTCGAGGGAGCTGACAGCGTC
GGAAGAGAAGCCCCTGGAATCAGAGACGCTCGCACCACAGACGGAGTCGCCGTCGCGCGCCCTCAAGGTGTTTGA
AGATCCCTTCAGGGACGACGACTCGCCGCAGAAGCCGACGATGAGCGTGCCGGTGCTGGGCGACAAGCCCATCAA
CGAAGATGCCGCACAACTTCAGCTGAAGGCCAACGGCGCCTCAGTCTCGACGGAGCCCGCCAGCTCGCCGGAAAA
GGCGCGGCAGAACTCGCGCCTACTGGACAGCGGCATCAACAAGATCAAGGCCAAGACACTCGAGGTGCATGGCTT
CCGCAAGCTGCAGTCGCTCATCCGCGACGGGAAGACGGCCATTCCGGACGACAAGTTCGAGCCCCTTGTACTCGG
CCTTTTCAGTTACCTGGAGGATCCGCTAGAAGGCCTCGCGGCGGATAAGGCGCAGGACGTCAAGGCGCAGATGCT
GGCGACGATGAAGCTTCTCCTCCGACGCGAGAGAGAAAGCTTCAGACCGTATGTGGGCCGAGGCCTCGAGTCTCT
CCTGGTGACGCGCAGCGGCTACGACGCAAAGGCGCACGTCGTCAGCGGTCTCGAGCTCCTCGCCGACGAACTCGT
CTCCCTCGGCGACTCGTCCGAGCTCATCGTCGTGCTCGGCCGTCGTCTCGAAAGCTGCTGCGACCAAGATTCTTC
GTCCGGAGGCTGTCGCACCCTCAGCATGGGTCTGGACATTGTCCGCCAAGTGCTGGAGAAGCAGATGGTACCAGA
AAGCGACGTCGACCAGCTCGTCCGTCTTGCTCGTCGGACCCTCGCCTCCACCGACTCGGGCGTCCGTATGGCGGC
CGTCAAGCTCTGCGTCGCGCTGCATCTCCGTCTCGGCCACGGCCCGTTTTGGTCCGCCATGGAGGCTGTTGCCGA
TGAAGCCAAGAGTCTGATAACCTATTATGTCGTCAAGCGGGAGCGCGAGCTGGCCGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail